SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005540 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005540
Domain Number 1 Region: 286-447
Classification Level Classification E-value
Superfamily Sec7 domain 9.03e-49
Family Sec7 domain 0.0000923
Further Details:      
 
Domain Number 2 Region: 492-625
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-26
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005540   Gene: ENSGACG00000004207   Transcript: ENSGACT00000005556
Sequence length 753
Comment pep:known_by_projection group:BROADS1:groupV:4855953:4891094:-1 gene:ENSGACG00000004207 transcript:ENSGACT00000005556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVELVTPPPAFVGASPKTGIIRRTLKYSETDLDAVPLRCYRETDIDEVLLAELDDGDSAF
GSNRSVQGTSGTGSSPLGGPAYGREDGAHQEERRLCGGVYRMSERTMETFFDNHHPALKS
PLLVSGPRCAAEDTFSRHFESIMESHRAKGTSYNSLDSEELLTSSAQTVLTFDLPTLTPA
IHGPVCHSARQIVQLSFAPLAHDERPSISDSIFTVTGDSDATRAPSSERLSSGSEDTPPR
GRGCSQLGSSWYSNPSFSLLSTQSHLRLDKIMQRPAGSGEQRHLTNGSRRADVAAARRLK
RLFTLDGFRKDVARHLSKNNDFSRMVAEEYLSFFNFTSLSIDQALRTFLRQFALMGESQE
RERVLSHFSKRYLDCNPKAMPSEDAVHTLTCALMLLNTDLHGQNIGKRMSCSFIGNLEGL
NDGQDFHKDLLKALYNSIKNQKLQWTLDEEELRKSFSELGDSLCETSASRPGKGGKPLTD
ETQHPSGSLLYKNGFLVRKVHADPDGKRTPRGKRGWKTFYVILKGLILYLQKGEYRPDKH
LSEEDLKNAVSIHHSLAMKASDYSKRPNVFYLRTADWRVYLFQAPNAEQMQSWITRINAV
AAMFSAAPFPAAVGSQKKFSRPLLPGTVSKLSEEEQIRSHEARFRALSTELAELHSYPPD
RKVKGRDLDEYRQREEYLEFEKTRYGTYVMLLRAKIRSGEEDLSVFESQLLEDNGLQRAQ
SSPTLQPAPTGRPETQLPAGRQEVSQGGGAPGA
Download sequence
Identical sequences G3NJM8
69293.ENSGACP00000005540 ENSGACP00000005540 ENSGACP00000005540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]