SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005563 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005563
Domain Number 1 Region: 224-367
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-41
Family Third domain of FERM 0.00035
Further Details:      
 
Domain Number 2 Region: 549-761
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-37
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 3 Region: 889-1038
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-31
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 4 Region: 747-870
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-26
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 5 Region: 124-226
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-25
Family Second domain of FERM 0.00019
Further Details:      
 
Domain Number 6 Region: 42-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.42e-23
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005563   Gene: ENSGACG00000004228   Transcript: ENSGACT00000005579
Sequence length 1055
Comment pep:known_by_projection group:BROADS1:groupXVI:9440844:9476371:1 gene:ENSGACG00000004228 transcript:ENSGACT00000005579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPEPMALGAGQRLGAPETLGISTLDPGHRPPAMPSGRHVTIRVRMLDDTEELFDVSQK
ASGKVLLDMVCSHMNLVEGDYFGLEFQNRQKMMVWLDHVKPIMKQLRRPKQTILTFAVKF
FPPDHAQLLEELTRYLFALQIKQDVSCGRLTCNDTSAALMVSHIIQSEIGDFEESQCRSH
LLNNNYIPDQIPLIDKIMEFHSKIIGQSPAESDYQLLEVARRLEMYGIRLHPAKDREGTR
LSLAVGHTGVLVLQGHSKINAFNWSKVRKLSFKRKRFLIKLRPDPNSSPQGTLEFLMGSR
DCCKVFWKICVEYHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQVIDYVRESEFKKI
PFERKHSRVQHNVRLSPLPCPRPQDVPTEESVLVSAEDTSASRTTSPSHQRNGREDRAGP
VSMAEETRGSTPPTHPERQSTGPAFQAAAKGSCSSAPFTDRGAVCSEYNQTMSPLAADPR
TEVAPNSPHPSASSGHSLGMVNGQRSLEPCGHSPDGRPPSPLTSPLLNHAGSVRTDEEDE
VRRKRFPTDRAYFIAKELLTTERTYLKDLEVVTVSFQSAVGQDEATPDSLMKNILCTFEP
LHKFHKGFLREVEQRLSLWEGRSNAHIKGDYQRIGDVMLKNLQGLKPLTANLHKQSEVLL
ELEKACRASRRLEGLCRDFELQKVCYVPLNVFILRPLHRLSHYKQLLERLCKHYPATHVD
FRDCRAALADVSEVVEQLQGSLIKMENFQKLLELKKDFIGVDNLVVPGREFIRLGCLSKL
SGKGLQQRIFFLFNDVILYTSRGMMATNQFKVHGQLPLHGMTIRESEDEWGVPHAFTLVG
KQQSVVVAASSLIEMEKWMDDIQVAIEMANTSNGPSSDLLTSSLIDNKRPDVSSADAECE
DDVTASRTSLERPAPHRGNTMVHVCWHRNTSVSMVDFSLAVENQLSGNLLRKFKNSNGWQ
KLWVVFTNFSLFFYKSHQDEYPLASLPLLGYSVTIPSETENIHKEYVFKLHFKSHVYYFR
SESEYTFERWMEVIRSVTVPLGSARILNSRESRPR
Download sequence
Identical sequences G3NJQ1
ENSGACP00000005563 69293.ENSGACP00000005563 ENSGACP00000005563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]