SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005588 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005588
Domain Number 1 Region: 3070-3381
Classification Level Classification E-value
Superfamily BEACH domain 5.62e-110
Family BEACH domain 0.000000146
Further Details:      
 
Domain Number 2 Region: 3498-3745
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.03e-33
Family WD40-repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 2971-3074
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-23
Family PreBEACH PH-like domain 0.013
Further Details:      
 
Domain Number 4 Region: 399-452,705-836,962-999,1056-1146,1196-1286,2243-2329
Classification Level Classification E-value
Superfamily ARM repeat 0.0000283
Family Armadillo repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005588   Gene: ENSGACG00000004223   Transcript: ENSGACT00000005604
Sequence length 3760
Comment pep:known_by_projection group:BROADS1:groupVI:4863479:4895739:1 gene:ENSGACG00000004223 transcript:ENSGACT00000005604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASNTLAREFLTDVHQLCSAVAQRAEAREEDEEESHMVALGEYLVRGRGFLLLSTLDS
IIDQELTCREELLTLLLSLLPLVWKIPVQEEKAPDFTLPSLLEVFLSREAKAAPLRAGHK
AATDEQNSWKRSRLSSGTWKSRRSRRTAQRYSVKDARRSQVSTSDSEANPEDKAAPGPGG
ARSRRSHGSAIRVSCQHHRSEASQLTSAAAETMSAPYLHPRPPGSQMVDTETLTDPAAIS
IFNRMENSPFDLCHVLLSLLEKVCKFDMSINHNPGLAVSVVPTLTEILTEFGDCCGPGGG
GGGGGGGTGAEELAGGWTEEPIALVQRMLLRTILHLMSVDVSQSETLPDSLRRSLTLLRA
TLKIQSCLDRQRDPFAPRHKKTLQEVQDDFSFSRYRHRALLLPELLEGVLQVLLGCLQAS
TPNPFFFSQALELIHEFVQHRGLELFEATVLRLEGLGRARDSEVGGETSERLRGLIAGIF
KIISAVKKAKSEQLHQSVCARRRHRRCEYSHFLHHHRDLSGLPVSAFKQAASRNPFEEDG
ADGDAVRYPERCCCLAACAHQCLRLLQRLSPSGPAVLQVLAGVQAVGICCCMDPCSVVGP
LLHAFKAPGLRSYQSHVLSVLGRLILDQLGGGQPSERAKLASCNICTLDSSQLPGLEETL
QHGEPSAAFTSLCYRSQGILPSGGGEEDMLWKWNALEAYQELVFGEDRQLSQQIAGHVCH
LTLRGNAVVQWQLYTHIFNPVLQRGVELAHHAQQLGVSTVCSQVCSYHTQCLPVEVLLIY
LQTLPALLKSRVIRDLFVSCNGLNQVTELVYLDQTRPLALRVFETLIMGVGHQQADGALQ
ELESADAEEREAVLGLAEDPGSRGAGEGPQSLSKFYEGLKEACPRQKSRGGQVRGAEAHL
RVINLFLCVAFLCVSKEAESDRDSANDSEDTSGYDSTASEPLGGRLPCLSPDCVALPSKE
QLRCAADVWAACRWVYMASPLFQRQFFQARRLETCLRLVTMVIQKLSSPRTCKPRRRGTE
RARAARSPQRPQRDRSRRLTIRPTPSALAKAKDPAKRQEEEWQLQSIRLLEALLAICLHG
ANSALQRIEPELPNQLQSVEETLFEVREQLSRSGVVNSDLAVPLFDSLLRVALAEVSSCP
DPPEEKPDRVSPALGETLQVVPSGDLSEEVDEGQSSGLKPPGEEEGYDADSESNPEDMAK
QEESAKVESAALHELLAMGDGTRGGVLLFPEICTMELKLLATGSPDLEVLSHVFHSLLGA
VRANPCNAALLYDQGGVKTILSGFHNILSRADPSFTDCQTVLVELLVAMVSQRITAEELA
LLIRLFLEKTTPTEILLKGILQIVEANVDIEPLHFLSFPIILGASSPGGSSSAARQNGAA
GGKSVGLLWKGKLSPARREGDAECRPSHLRSSPWHIAPLHLPLVGQNCWPHMASGFSASM
WLRVAEREEKTGEKDKEPSNAPAAESHHGASEAATRLLEEGLVHILSMGSKALMLQVWAD
FSTGALTFRICIDPNDEIKAGLLAQADSGGGLLDPGRWQHLGLTYAQQPEGKKNIHGCVV
VWVCGIRKCEVSLDYTLPRKSSLSSDSNKTFCMLGHCAPSSEDLLAQSGRWTMGTVLLFN
GSRIGHEEALYLYTSGPDLTSIMPCKYGKPSGTVSKFVTLESLKSDHVRELLMKNKGVDT
SALVESLAVVYAPSSPRVYTIYEPVIRIKGQAKTVVTQRPFSSKEVHSVSLEPSFLRAFL
PTETRGLQSVLHKIGGTGNFVFLFAQTVELSDCEKTQALALRVLLSLSKFNQHRIHEMDC
YHGYSMIHQVLIKSKCTVGYHMLKTLLDGCFSAPILILGDNGQFRLDTESIAVVLDIKLL
SDVLLDWKIWAKAECGVWETLLAALEILIRVHHPYQVFNIRQFLKAEVVHRFLLTCQVLQ
EHRGEHLTAIPQEVCLSFIKIIQEVLGSPPDIDLLKLIYNFLLAVHPPTNTYVCHTPSSF
YFSLHIDGKLYQEKVQTIMHLRHSNSGGKSTSSSVVSLSPTVFTDVSHDGHLQAPSPEQG
GDNQSLRLPSLAPSPYSSPLLTPRLGHGISSEAGEADGLSFATQQALGSTETLKRGGGDE
QLLSSCESAKTICESKDIGEGGAPRTPSISVEEERDEAAEVSSLAEGSIGVAESEDRFDW
ASDEAPRRPDSLKGIQSFQRSHSNLASLGLAFPAPNGSLAVGRWPNSAERGSMPEDWESY
TYSPGYERAHSKTESSDGSSTEDCLVLICCGLYDLLRGILLLLPDLMLEEVMDKLIQPDA
LIVLVNHSSPLIQQGVMKLLDAYFSRAHKEQKEKFLKNHGFSLLANQLYIHQGSQGLLEC
FLEMLFGRPVGLEEDLDLEEMENISPFRKRCIIPVLGLIENSLYENSLVHNILCMLLQLL
NACPKLADILLDHGLLYVLFNTLSTLNGMELGIPLNDYKLLVCDIQQLLVAVTIHSCSSS
GSQYFRIIEDLITLLGFMQTSKMRRTQEMAVALQFRVLQSAIEFIKTTANQEPQKLSSSV
NTPSSPHHAIHQKRKSIAGECRRRFSLAQTDSLLMRMRSVASDELHQMMQRRMSQENPIR
ASETEFVQRLQRLVVLAINRLIYHDVSQDLFDLLNIPDSPDQPFLTPDPGDQPQDESGAG
SVSHSPIPFALPPASKKSFQKDILRLMMDGIKISLGSSGRGGAPHQQWRRILWSCRDTFR
VQIGRLLVHTLSPTLPLSDRKESLEFVFDHRHLDILKESLSPGLEHGPKLCLYLYEMLHD
HKDSLTKDEQNAVGVFMTSLKLCGHRCIPPNSPHKQDLLKAMKEEKLKYEAEEKTSKVAW
EKKMTNTQRNLIQRLDGKSKDISKIAADITQNVSLRQGMERKKVIQHIRGLYKTDLSASR
HWQELVQQLTHDRAVWYDQTSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLKDRRKF
EDTVKPPLSFLVEDKTHSSFSSTVKDKATSEPIRFTRRCISVAPSRETAGELLLGKSGMY
FVEDNAADAHDNQSLHGETEAPSFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLIAF
DNSKFRDDVYHNILTSDLPNLLEHGNITALTQLWGSGQISNFEYLTHLNKHAGRSFNDLM
QYPVFPFILRDYTSETIDLQDTNIYRNLIKPIAVQSKEKEDRYVDNYRYLEDEYKKGVRE
DDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRL
SSFESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIH
RQALESDQVSQTLCQWIDLVFGLKQKGKAAVHAINVFHPATYFGMDVSAVEDPVQRRALE
TMIKTYGQTPRQLFNASHLSRAGPKLLMEGELPAAMGLLVQLAFRETREQAKEIVCPSPL
PWIKGLKWGEYVGSPSAPDPVVCFSQPHGERFGSLLALPTRAICGLSRKFCLMMIYSKEQ
GVRSMHSTDIQWSAILSWGYADNILRLKSKQSEPPINFIQCSQLHQVTSCAWVPDGCQLF
TGSKCGVITAYSNRFTSTTPSEMEVESKVHLYGHTGEVTSLFVCKPYSILISVSQDGTCI
LWDLNRLCYVQSLTGHKSPVTAVSASETTGDIATVCDSVGGGSDLRLWTVNGDLIGHVHC
REIICSVAFSNQPEGVSVNVIAGGLENGVVRLWSTWDLKPVREITFSKSSKPIISLTYSC
DGHHLYTANSEGTVMAWCRRDQQRMKLPMFYSFLSSYAAG
Download sequence
Identical sequences G3NJS6
ENSGACP00000005588 69293.ENSGACP00000005588 ENSGACP00000005588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]