SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005608 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005608
Domain Number 1 Region: 121-250
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-24
Family Pleckstrin-homology domain (PH domain) 0.00000211
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005608
Domain Number - Region: 1373-1565,1670-1711
Classification Level Classification E-value
Superfamily ARM repeat 0.000317
Family Armadillo repeat 0.073
Further Details:      
 
Domain Number - Region: 815-975,1085-1136,1258-1296
Classification Level Classification E-value
Superfamily ARM repeat 0.00446
Family MIF4G domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005608   Gene: ENSGACG00000004237   Transcript: ENSGACT00000005624
Sequence length 2059
Comment pep:known_by_projection group:BROADS1:groupXVI:9502200:9533558:1 gene:ENSGACG00000004237 transcript:ENSGACT00000005624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPKVIEPLDYENVLVQRKTQILSDVLRDMLQFPLEDFEISTLRRQGRTLYPTVPEGAERE
AQSLFVQECIKTYTSDWHVVNYKYEDYSGDFRQLPNKVSRPDKLAVHVFEVDEDVDKDED
ATSLGSQKGGISKHGWLYKGNINSAISVTMRSFKRRYFHLTQLGDGSHNLNFYKDEKISK
EPKGTIFLDSCMGVVQNNKVRRFAFELKMQDKSTYLLASDSEGEMEDWINTLNKILHSSF
EVAMQEKRNGDIHDDEDLGKSDSSSGSMDSFQEIPFSSSQSARDIESRMRNETRLKLFTL
DSDTQKLDFSGIEPDVKQFEEKFGKRVLVNCNDLSFNLQSCVAENEEGPTTNVEPFYVTL
SLFDIQNGKKISSDFHVDLNHLSVRGMLPSNTTQYMNGGGDTHPEGPRLVHGVPEASMQY
PRQGVFSVTCPHPDIFLVARIEKVLQGGINHCAEPYMKSSDSTKVAQKVLKNAKLACCRL
GQYRMPFAWAARSLFKDASGTLDKGARFSPLYRQDNNKLSNDDVLKLLADFRKPEKMAKL
PVILGNLDVTIDNVAPDLTNCVTSSYIPVKQFEVSEKTSIFFEVEEFVPCIAKCSQPFTI
FNNHLYVYPKHLKYDSQKSFAKARNIAVCVEFKDSDEEEAVSLKRIYGRPGGPLFTKNAF
AAVLHHQQNPEFYDEFKIELPTQLHEKHHLLFTFHHVSCESNSKASTKKRDLVDTQVGYA
WLPLLKDGRVTMNESQIAVAANLPAGYLNCQEAASKHSGPEVKWVDGGKPLFKVSTHLVS
TVYTQDQHLHNFFHHCQSIAATPQVSGGQLVKFLKSLHAMESHVMIKFLPTTLNQLFRVL
TSATQEEVAVNVTRVMIHIVAQCHEEGLEHYLRSYVKFVFKSEPQTSSPTRLVHEELAKA
MTAILKPSTDFLTSNKLLKYSWYFFEALVKSMAQYLIESCKVKLSRNQRFSASFHHTVET
LVNMMMPHITQKYKDNLDAARNANHSLAVFIKRCLNLMDRGFVFKQINNYINCFMPGDPK
TLFEFRFEFLRVVCYHEHYVPLNLPMPFGKGRIMRFQDLQMDYSLTDDFCKNHFLVGLLL
REVSAALQEFREIRQIAIHVLKNLMIKHTFDERYTSKSQQARLATLYFPLFGLLQENVNR
LNVKEVSPFTVNHSNNNGREDLLLSNALMTPPRSSTFLDTSLHKDVFGVISGTFVDAASP
HASSTPNINSVRLAESRGSLISTDSGNSLSEKNNDKSNSLDKNQAASTPGSSLLRCDKLD
QAEIKSLLMCFLHVLKSMSEDALFTYWNKASSAELMDFFTLVEVCLHQFRYMGKRYIARN
QEGAGPVAHERKSQTLPVSRNRAGMMHARLQQLSSLDNSYTFNHTYSHSDADVLNQSLLE
ANVATEVCLTVLDTLSIFIMGFKTQLCTDHGHSPLMKKVFDVHLCFLRINQSETALKQVF
TSLRTFIYKFPCTFFEGRADMCAAFCCEILKCCNSKLSSIRSDAAHLLYFLMKSNFDYTG
RKSFVRTHLQVVIAVSQLIADVIGIGSTRFQQSLSIINNCANSDKTIKNTAFPSDVKDLT
KRIRTVLMATAQMKEHERDPEMLVDLQYSLAKSYASTPELRKTWVDSMARIHVKNGDLSE
AAMCYVHVAALVAEYLRRKGMFKQGCSAFRVVTPNIDEEAAMMEDVGMQDVHFNEDVLME
LLEECADGLWKAERYELISDIYKLIIPIYEKRRDFEKLAHLYDTLHRAYSKVTEVMHTGK
RLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKFTPLSEISQRLLKLYSDKFGQENVKIIQD
SGRINPKDLDSKYAYIQVTHVTPYLEEKELVDRKTDFEKSHNIRRFVFEMPFTISGKKQG
GVEEQCKRRTILTTTHCFPYVKKRIAVMYQHHTDLSPIEVAIDEMSKKVAEIKHLCSSSD
VDMIRLQLKLQGSISVQVNAGPLAYARAFLDDASAKKNPDNKVKQLKEVFSRQFVEACGH
GLGINERLIKEDQQEYHDEMKASYRDLAKELSIIMHEQISPVEDGMKSVLPDSLQIFNAI
SGTPTSATIHGIPSSSSVV
Download sequence
Identical sequences G3NJU6
ENSGACP00000005608 ENSGACP00000005608 69293.ENSGACP00000005608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]