SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005612 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005612
Domain Number 1 Region: 1771-1924
Classification Level Classification E-value
Superfamily SET domain 1.44e-43
Family Histone lysine methyltransferases 0.0054
Further Details:      
 
Domain Number 2 Region: 458-526
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000186
Family PHD domain 0.014
Further Details:      
 
Domain Number 3 Region: 550-614
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000624
Family PHD domain 0.0091
Further Details:      
 
Domain Number 4 Region: 414-467
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000952
Family PHD domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005612
Domain Number - Region: 668-697
Classification Level Classification E-value
Superfamily Bromodomain 0.0288
Family Bromodomain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005612   Gene: ENSGACG00000004248   Transcript: ENSGACT00000005628
Sequence length 1924
Comment pep:known_by_projection group:BROADS1:groupX:6640279:6657863:-1 gene:ENSGACG00000004248 transcript:ENSGACT00000005628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGANKTMLHLLKKAKVQLIKIDQQKQLKLSQGVRGETPAFAHEAAANQPQLLLCIRNPG
KTLNNERKRMQEQPLGGPRIKHVCRAAAVALGQPRATVPDDIPRLSALPLHEREGISFSP
AAEGSQWLLVSVEPRQKTSKTGLRGLSLRNTSSKGLLFRKRKPLSRYAPGGVRARRCGSC
KGCLIEEDCAKCINCLDKPKFGGPNTKRQCCVYRKCERIEKAKIERVIQPIKPIFLAPQD
GGSLRDEPPAEAVKPRRPFSRGAGGRPRVYKSAVSLPKQSPQTPDQRLSLSRPLLSHFIT
PPAISHSNSTPASPPQRARPVAPSDSALPPQTRPVELTKRKPYKCTLRKSIHTHSYRRNP
AECASVNTLTGLANGFPQKGLLQNKYKIRVDFKEDCAVQNVWLMGGLSVLTSVPSTPQPV
CLLCASKGRHEMIFCQICCEPFHSFCLSPDERPQKENKENWCCRRCKFCHVCGRRSKSTK
PVLQCRRCQTSYHPSCLGPTYPKPMNCNMPWVCMTCIRCKSCGVTPGKTWDLAWNHEQDL
CPECTSLHKKGNFCKVCHKCYNDNNQHTQMIQCSACSHWIHYTCEGLSDELFGLLSSQPE
DSFTCSLCSEHQTERSSLKEELQSRLIAGLEEVLSDLLSADTTQHLLLCRVCQEPNNTQS
FREQHPVCDLQAMEKKFKSGGYASIKAFHSDVVFVMRKWLKEEERLPEDQRPTSMARACY
VKLIAQVFNGFPPSFLKKCNTFSLEFPSGMLPEAVLPPSKEHSYAQWLERTYQPKVTRGQ
LAGKPDSVMSSGDKRALKTTKSEDMRQCALCQQNGDYAPKDAGRLLYLGQNEWAHINCCL
WSAEVYEDNSALLQVHSAVSRGRHLRCDRCGQSGATVGCCLSTCQSNFHFMCARAQNCVF
QLDRKVYCFNHRDLVSAKFEMVTGRGFEVPRRVYVDFDGINLRRKFLTGLDPDSINMTIG
SLQIQKLGVLSELSSNGRMLYPVGYQCSRLYWSTVDPRRRCKYTCKVTEVTTPLPGEEQD
PKWDKEENHTIVHCPTHHRVSMKCQFCNMTPFFLPDMDSPNRLSSSSSPIKSTTPSPESK
HLHTPGSKSPGYTQTRRPAGGSSRPLPSPGSALPKSHHILTLRDLEDPRRPRRLSSRSRC
SSSPTDSDPSVPMTLRSGGTVHTRCALFSSPPSIAAGLSPRRGAMTHSPKDTEVAVASML
NAKLEFDEALLTENVTLHCGAQGGRGDAAGVAQDVEMHVDNRENSEDEDSSHYLKFSRTV
VRDAAGSSETSEPLTSTQSISQFDGADGGSESDESEVVDDEAKDTEQQGENSTTGHFVSS
DDAIAVCPNMVKFGLKDDSSSSTDSVEAFKDDLNDPDYSPKSPPVPEAKTKKTPPTQMKA
IVVNTKHPVSNLKRLSPKPCLPQQQTSQVLLVNRQGQILIKDPRSNTYQSLSANSPAYNK
IIVPVNSIATPAPPSPISVQSVPEATFSSIKLPAKPLESPSGSLDEPNSCPPQTPASSRQ
PVRIKRVSSVSERSSKKKSKMDFLRDPSSELGERDEIRPSGVRMKAPTMSGIPDVEQEKM
LREPEQLRITAPPLPPATLPRSVQQSNIDLNYFLNTGFCFSSDEDASAPKHRKRTYMNQP
HLRFEITSDDGFCVKANSIEVAWRAVIDGVLEARAGFHLKQLPLGGMSGPRVLGVVHDAV
IFLLEQLQGAANCKRHRFRFHRCDDIKEELPLNPSGCARTEVYARKATFDMFNFLASQHR
ELPDIVGPFDEEEDEFPLKSSRRATSSELPMAMRFRHLEKISKEAVGVYRSEIHGRGLFC
KRNIEGGEMVIEYAGNVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMQGNAARFI
NHSCEPNCYSRVINVDGRKHIVIFALRKIYRGEELTYDYKFPIEDENSKLRCNCSTRRCR
RFLN
Download sequence
Identical sequences G3NJV0
69293.ENSGACP00000005612 ENSGACP00000005612 ENSGACP00000005612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]