SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005711 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005711
Domain Number 1 Region: 176-271
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.7e-31
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000923
Further Details:      
 
Domain Number 2 Region: 256-373
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-30
Family UBX domain 0.0000142
Further Details:      
 
Domain Number 3 Region: 3-45
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000459
Family TAP-C domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005711   Gene: ENSGACG00000004309   Transcript: ENSGACT00000005727
Sequence length 375
Comment pep:known_by_projection group:BROADS1:groupXII:3884103:3889170:1 gene:ENSGACG00000004309 transcript:ENSGACT00000005727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMASQQESVREFVAVTDVDEERARFFLESAGWNLQLALASFFEDGADDDIVTLPQPEIGS
SVSRSAGPSAQPRVTSFRDLMHEAEDESDEEEGQRFFAGGSERSGQQIVGPPKKKSSNEV
VEDLFKGAREHGAVPLDRPGRGPGESSKARAFIGGGYRLGAAPEEESAYVAGERHGSKGQ
QDVHVVLKLWKTGFSLDNGELRNYSDPGNANFLEAIRRGEIPLELRQRSRGGQVNLDMED
HRDEDFSKPRMAFKAFGGEGQKLGSATPELVSAQATSQQDQAAIEAEASSSVTLDSSQPV
TNIQIRLADGGRLVQRFNYTHRVSDVRQFLVGARPAMAAREFVLMTTFPNKELSDEGLTL
QQANLLNAVIVQRLN
Download sequence
Identical sequences G3NK49
69293.ENSGACP00000005711 ENSGACP00000005711 ENSGACP00000005711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]