SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005764 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005764
Domain Number 1 Region: 61-157
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-29
Family Ras-binding domain, RBD 0.00014
Further Details:      
 
Domain Number 2 Region: 385-492
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-28
Family SH2 domain 0.00000845
Further Details:      
 
Domain Number 3 Region: 193-307
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005764   Gene: ENSGACG00000004362   Transcript: ENSGACT00000005780
Sequence length 496
Comment pep:known_by_projection group:BROADS1:groupV:5094185:5103036:1 gene:ENSGACG00000004362 transcript:ENSGACT00000005780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSPPEPDAPPIRRSQPIVITVNRYVRTAKGVDSLSSSVPNPFPELCSPSKSPVLVGSFP
PPTSNKHLIKVFGEDSHSRSVWVSRGATTREVCHMLVQSAHCSDQESWALLEVHPTLGLE
RCLEDHEVVLEVQATWALKSDTRFVFCKNYAKYEFFRKPMQAFFPESMISDSADDRKGMT
SSDLIQNLLVSGTCPEIQGFLQVKEPSRKSWKKVYFFLRRSGLYCSNKGSSKEPRHLQYV
ADLDDLNVFTVVNGRKLYGAPSDFTFSIKPTKNPPRLQDLKILSADSEQTRTCWTSAFRL
FKYGKQLQSNYQLSKVPPQKPEGAKDVKAKSEASLVAMDFSGKTGGRVIQNPAEAQSAER
EEGQAWRRREALRSSLPNLNSAAKPSTAIHKSQPWFHGRVSRKETQRLIEKQGLVDGMFL
IRESQQHAKCFVLSLCYKLKTKHYLVIPCEDDGRRYYTMDDGVTLFIDLLQLVEFHQINK
GILPVCLKHPCVCVAL
Download sequence
Identical sequences G3NKA2
69293.ENSGACP00000005764 ENSGACP00000005764 ENSGACP00000005764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]