SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005780 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005780
Domain Number 1 Region: 128-339
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-52
Family DBL homology domain (DH-domain) 0.0000812
Further Details:      
 
Domain Number 2 Region: 354-472
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-16
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005780   Gene: ENSGACG00000004380   Transcript: ENSGACT00000005796
Sequence length 511
Comment pep:known_by_projection group:BROADS1:groupXIX:6111536:6118519:1 gene:ENSGACG00000004380 transcript:ENSGACT00000005796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKCEERCIIKRIGLRPPLQRGSSFTFRTPGTPWDFSLKRKRKEKEDDTVSLSSFDLKEP
STKRNRPLAKVSSLVNLISPSKNGAVRRFGQTIQSMSRGDSKSPGTSLKAGSKTAGPTPT
KRRNSTLWSETLDVHQKSTFSTKEIKRQEAIYELFRGEQDLIEDLQLARKAYHDPMLKLS
YMTEEELAHIFGDLYAYIPLHEDLLMKLTEGTGPDGTVAQIGQIVIDWLPGLNAYKGYCS
NQLAAKALLDQKKQDKRVQDFLQRCLESPFSRKLDLCSFLDIPRSRLVKYPLLLREILKH
TPAEHPDIPSLERAITIIQEILSDINVRKGESECQYYIDKLEYLDDKQRDPLIDNCKILL
CHGELRNKSGSRLHVFLFSELLVLTRPVTRNDRSCFQVYRQPIPIRDLSLEDLQDGEIRM
GGSFRGAFTNGEKAKNVFRVSSVDPSHGQSHTLHVNDVYHKQQWLNCLRSAMALQQEAPL
GAQQEGARRAKRRSSTISVTICDEETDENCP
Download sequence
Identical sequences G3NKB8
69293.ENSGACP00000005780 ENSGACP00000005780 ENSGACP00000005780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]