SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005781 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005781
Domain Number 1 Region: 403-504,543-785
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 6.28e-112
Family Oxysterol-binding protein 0.0000533
Further Details:      
 
Domain Number 2 Region: 78-191
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-20
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005781   Gene: ENSGACG00000004382   Transcript: ENSGACT00000005797
Sequence length 786
Comment pep:known_by_projection group:BROADS1:groupXX:2244362:2274397:-1 gene:ENSGACG00000004382 transcript:ENSGACT00000005797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVKATGGAKPGGSSSGMERPARPESPAWSPCRRQQQQRLSEPCGSAAAVQRPGTTGTTGD
GGAGSSPSLHKPARCKRPLEGILRKYTNPLQGWQSRYFVLDSEDGQLQYHLNELSKGQRP
PRGSVPLLGAMVVSCDEYPYMFTIRSTSGDAYKLRAIDAQEQELWMTQLQLCTRRRSESS
AKDFNCDSVPSSNSSSLAVSSASAADSPSPERDTRAGEIIVTAIKEAASCAESRKTKHYY
YKKNFLEDYRNRVMIQAEDQQKSLINSVESLPPRVGPLSSLDEDLLIFKATSAATLSCLG
ECLSMLQHNVVQALNQNQNQNHAPNGTAGWSRSLSVKQVNNGVRTPLPSSTRPSSSPTHK
DPSEDSQQGQQQAQTSSPEALDPCDEVTDTDDNEEEDLGVLDDQRSIMLHLLSQLKLGMD
LTRVVLPTFILEKRSLLEMYANFMAHPDMFLSITSGCTPEERIVRFVEYYLTAFHEGRKG
AVAKKPYNPILGENFHCSWYVPRDRVRPLRTANFTAPNSAPTATCTIPGSPQRGADGSRR
ANADCYCVRFVAEQVSHHPPVSGFYCECKEKRMCVNTHVWTKSKFLGMSVGVSMVGEGVL
YLLEHDEEYVFTLPCAYARSILTVPWVELGGKVTINCAKSGYSATVTFHTKPFYGGKVHR
VTAEVKHNQTGNVVCKAQGEWNGVLEFTYSNGETKAIDTSKQPIIKKKILPPEKQGPYES
RRLWQHVTASLKSGNMDAATEHKHRLEERQRKEGKQRAATKTPWKPKYFIKEGEGWVYHN
PLWKAH
Download sequence
Identical sequences G3NKB9
69293.ENSGACP00000005781 ENSGACP00000005781 ENSGACP00000005781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]