SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005787 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005787
Domain Number 1 Region: 842-1078
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-54
Family DBL homology domain (DH-domain) 0.0000317
Further Details:      
 
Domain Number 2 Region: 1075-1204
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-35
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 3 Region: 656-711
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000068
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0083
Further Details:      
 
Domain Number 4 Region: 160-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000326
Family Ankyrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005787   Gene: ENSGACG00000004374   Transcript: ENSGACT00000005803
Sequence length 1535
Comment pep:known_by_projection group:BROADS1:groupXIII:1800877:1831918:1 gene:ENSGACG00000004374 transcript:ENSGACT00000005803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSRRRVPLYGQAKVFALLEGYDSVPEDAEVYIVLEGSTLVHVTRAQSDVMLCFIVPGH
NLAEVVSVQAYLSSGTALVTWVGGASLEYVQDDAQDLAEHLVMHAHCLSSKDHTELSSLF
NLGQESSRGAMDRRVALAVANLDIPRSWNVLGSHGGDERTPRESPLHLAVRWGLFRLAEL
LLCQPGGLMAVSLPNQEGVTPLQLAQTAANTEILELLAHPPNPLATPPAGLSQVWADRSR
LLRFCHDSGNLTLTVRQNLRWSSEESRHADILLLRERLRDQDFLREAALRPMRAQELTGP
RGAADVLSKRRGRGKEKGQTERENSPGSVVQSVRGLSREEEEDSGQTQSTRESQAQSPTL
AAAVRLSAMIHGKGRVFANAMLVDQVDGADIKYRLGRPCSFSTTPPASRNHAQDRHPPSP
RGGEKGIRGPEIRKEPSCRTSPPSTFTSPPSFPSSPLVSAFRLYEGGQRRPCLPVSPALN
RRGYSLTEASQGLSPSLEGDSGEEDILGHSYPSSSVKKQSIPRSSSREERDSFEASPDFN
RLHSPPKSASSTQSPEEAEVRLRSYSFSSPKAKPSRPLLNRDTTVADQAEEQRAFSLTET
TKEKRIEDEEWDKYIIPSKVESEKYKVSRTFSFLKSRMSSTRNKTKVKGKEAKEGKEKAG
ATNGHQFVSASPPSAALCVGCDRSVSGKELLQCSNCFLNVHKNCRESVAACGKATSPLDM
MTIIMGVVGSGSIDVKPAPGNNARDKGGLIVCAPVGDSVKDNSPSTFCSSASLPTTTREK
RETAGPLSKSFSVSIDSRLERDRFREEKGERRGAPFLSHTDGVDAPLMSGLSAEELGLEV
ESWSLAVSPEFCRQHDRHTIKRQEVIYELMQTELHHIQTLTVMSGVFRRGMLEELQLDWD
CVARIFPCLDPLLLFHKNLFGALLERRQAAAHTDTPGDYLIHQIGDILLQQFSDEYAEEM
KQVYGEFCSHHTEAVNVFKELQQQNKKLQNFVKQQSNNTLVRRREVPEFILLVTQRITKY
PVLLERILHYTREESQEHADLSRALAQIRNIIAAVDLTVNRHERCQELQEVLVRLENKSF
AKLKNDKVFRKQDLHSQHRVLQYKGLVYWKTATGRLKDTLALLLTDVLVFLQEKDQRFVF
AAVDQKPPVIPLQKLIVREVANEERGMFLISASSVGPEMYEVHTNTRDERNAWMRHIRQA
VESCPEEEEEEERTAEIEESRRVAELRVQKISKFQEMLSGQDQLICNSLEEKLQLYAELT
EFTLRSPEPVPHRHLVLADPDAETPRQASALLIAALREGESVAGRRGVAVAKRDKIRQNS
CFAPSAAENLIVPATRPKDQSAAATTAGGAACTSLHLSVSHFGTPTRHRSVFTDAGERRR
DVAESVQNLTQLLYSLQAAVTVQDSCYEVQKLLLLEGERPQLHLVSIKNDDRVSVVILHV
KLKQVQQRWDKECLARDKRQCEQESVLEQREHRCLLEAERLRCEREELEAQLLEYQQNLE
RLKAGQRSVEREKEKIEAQQRLLQRWRHHRQSSLP
Download sequence
Identical sequences G3NKC5
69293.ENSGACP00000005787 ENSGACP00000005787 ENSGACP00000005787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]