SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005826 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005826
Domain Number 1 Region: 590-952
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.88e-120
Family Oxysterol-binding protein 0.00089
Further Details:      
 
Domain Number 2 Region: 93-195
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-18
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005826   Gene: ENSGACG00000004410   Transcript: ENSGACT00000005842
Sequence length 962
Comment pep:known_by_projection group:BROADS1:groupXVI:9608839:9626233:-1 gene:ENSGACG00000004410 transcript:ENSGACT00000005842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGVHGRTMSTEERSSPPVLKSSTPVHKSASSSSSSQRDSRQFMHLTDLKTLTAQLKSLKH
QLCFPQIQRQLQEADSWEIIEGLKIGQSNVQRPDKHEGFMLKKRKWPLKGWHKRFFVLDN
GILKYSKSPIDIQKGKLHGSIDVGLSVMSIKKRARRIDLDTEEHIYHLKVKSQDIFDAWV
SKLRHHRLYRQNEIVRSPREATMRTFPPPAAKESPKPAPSEVREAKAKPSSLPWQPVAPS
SNSSLPASYSNGQSKVVAWLQESEEMDKCAEELARCQSNLTELSRLLQSLEILQRTQSAP
NSTCVTKTNCVEMSKKEKRLNRRWRTKSVGKDAKFQLQVQDTQTHSTCKCPLVVSLQVPL
SASMSPVRLHSSNPNLCAELVDFQPPVTRLTDSTECASDYIKLQEEFCTIAQKVHSLLKS
SFNTVAIEKEKIKQILSDQEQSDQSAQINSLRKSLSQALSQNAELRTRLNRIHSESVLTE
QVVSVNIISTPEQAGDQMGIPLTQQASNESRLSMSESVSEFFDAQEVLLSASSSENEGSD
DESYVSDVSDNISEDNASVTDNVSRQMANGDFAGSAFRNGRRSCLPAPCPDTSNINLWNI
LRNNIGKDLSKVSMPVELNEPLNTLQRMCEELEYSELLDKAAETEDPLERMVVVAAFAVS
GYSSTYYRAGSKPFNPLLGESYECIREDKGFCFFSEQVVSHHPPISACHCESKNFTFWQD
VRWKNKFWGKSMEVLPIGTVNLMIPRFGDQYEWNKVTTCVHNILSGQRWIEHYGEITIRN
TKSSACLCKLTFVKGNYWSSNVNEVQGFVMDQEGKVVHRLFGKWHEGLYCGVPPSAKCIW
RPGSMPTDYELYYGFTRFAIELNELCPELKDVLPRTDARFRPDQRHLEEGNLEMASSEKQ
RIEDLQRVRRKCNDENNVKLEPRFFKKVVDGNHRERWVSNNTYWELRKNPGFINMESTMN
LW
Download sequence
Identical sequences G3NKG3
ENSGACP00000005826 69293.ENSGACP00000005826 ENSGACP00000005826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]