SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005831 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005831
Domain Number 1 Region: 748-824
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.42e-18
Family PHD domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005831
Domain Number - Region: 29-88
Classification Level Classification E-value
Superfamily Histone-fold 0.000869
Family Archaeal histone 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005831   Gene: ENSGACG00000004409   Transcript: ENSGACT00000005847
Sequence length 835
Comment pep:known_by_projection group:BROADS1:groupXIX:6145672:6152099:1 gene:ENSGACG00000004409 transcript:ENSGACT00000005847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRGTDRDLYRNEISEMCESYARSLLRVSVAQICQALGWDAIQLTACDQLSDVLHRYIQQL
ARVCHRYSELYGRTDPVLDDVSQAFRLLGVSLSELEDYVHNLEPVAFAQQTPLFPVSKNN
VLQFPQPGARDAEERKDYIPDHMPPLVSLQEEEEAEAAVLADMGTSAEAMQVALEDDEEE
VDEDETVNDENHPLKRHLDSPDAALGMMPTSKRPRMYPGLSPEWGVEPREPLTSLNPQRV
PPGVLPTHDSLDPLSPETPSGALPPFRPQPVVPKHSDQKGLTTPGRKSKVSSPGRQRTKS
PKGVIPVPVGGSPIHSPKAPKEKKKSPGRAKSPKSPKSPKMVSAKASQPQNKTDGMLKLP
LCALNERMGKENIHMRQNIEDRELAEGPFKKIEPDNAAIDDSIDAVIARACAEREPDPFA
FSSGSDSDSNGFSSPKRLTIMEPPTPKLSIGISVKDTATPLHLQAHAGLGNWTMDDSINE
VIRKVNQRGPSAPPANIAEYVSSGSASPPTPEPLLKMFEEKNKIVPPVDIPKDAKMPWKE
FGVRDDEHFLIRDFTLPEGSIKIKTRDGDGPKKEKEEDRLKASALGEMAPLFSPSACLRL
PSMLPSLAPILQDKDGIRLEKFAMSLRNPVTSVTHEYPVPPFAQVKADAPAALPSPVIPR
LTLRVGAGQDKIVISKVVPNSEPKTPAPKPPVARLGPGNRPQAPPLLPVLCPVVPILPPA
PSPLPPPPAPPSLLPSGPLLSPAASFKTPVRSVVTETVSTYVIRDEWGNQIWICPGCNKP
DDGSPMIGCDDCDDWYHWPCVGITAEPPEDQQWFCVKCASRKKDKKHKKRKHKAH
Download sequence
Identical sequences G3NKG8
ENSGACP00000005831 69293.ENSGACP00000005831 ENSGACP00000005831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]