SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005835 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005835
Domain Number 1 Region: 168-383
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-51
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 682-937
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000058
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 396-479,570-626
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000114
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005835   Gene: ENSGACG00000004412   Transcript: ENSGACT00000005851
Sequence length 1135
Comment pep:known_by_projection group:BROADS1:groupXVII:1957372:2014039:1 gene:ENSGACG00000004412 transcript:ENSGACT00000005851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVIYDDVPCEGPLSPDEGERPCLYDLRGRPERRRPLDADNGWSSSEFERFMPNSTYFYTS
EVSIPPLSKALTLYAERSPDVCRLRERCARTKRELATRLSGKHNYDIKVQQLMKAARSGT
KDGLEKTKIAVMRKVSFLQRKDQLEEEDDAGYLDVAMSEMKHPPPQLSPMPEGLTNHQVV
RRHILGSIIQSERSYLESLRRIGQEYQRPLMEADPRILSPRKLRPIFYRMREITQCHSMF
QIALASRVAEWDSSEKIGDLFVASFSKSMVLDVYSDYVNNFTNAMALIKKACLSKPAFLE
FLKKKQATSVDRITLYGLMVKPIQRFPQFILLLQDMLKNTPKGHVDRLPLQLALTELETL
AEKLNEQKRVADQIAETRQLARSVSDRLLSRQLNSEQGSLVLCETLIETVYGERGQVLKS
KERKVFLFDDVLVCANINVKFVSTRGPPDVSSLVPVGPKYTMKWSAPLQQVQVVEVGQEV
SQSQDALFQQSGAKRAGPPVQQSKAFLGPPRLYQELQELQHDLSVVEEVTLLVGTLQGTY
QNLNTTVAQDWCLALQRLIRMKEEQIQSANKCRLRLQVPGRPDKSGRPVSFMVVLNTPSP
VSKISWVNRLHLAKIAQREENSPGWVCGQDEGKSIAPFWCPLLACHMPVFATKSPDRKLE
AALHNPVHCALLGFSAASTSLPQGYFWVAGGDGAHGQIEIFSLNRPTPRTVKSLPVDAAV
RCLEYVPEPSPSEEAEAGVHKASGVGASICVGLDDGRVLVYGSVDTAAQCLLTLAAAEGS
PVLCLKHSARFLFAGLRSGALMVYGRKEDDALWDPDSCRCVKLGSQPVRTLLVLDDSVWA
SCGNSVTVVDVSSLSTQQTFEVHPDPMISVAHTACAGGGVWMAFSEGSSIRLFHTETLEL
LQEINVSTRSTLLNTGQKSVRVTSLLICQGLLWVGTQGLIITLPVPKLEGIPKITGKGMV
SLNAHRGPVDFLAATSGTLSPELLKRDSVADGPDSAFGGDASSQESLQHCYQGEGRGKGR
GVLLQYKLRSTSGLPGQPLTAAGGDAAASDSSLESLEHSVEDGSIYELSDDPEMWVRGRP
CERDGGRRDRVVSAAVISGGKGFRRLKEGAAAAGAPSGGEGLENVLMVWQLPLTV
Download sequence
Identical sequences G3NKH2
69293.ENSGACP00000005835 ENSGACP00000005835 ENSGACP00000005835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]