SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005873 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005873
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000212
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005873   Gene: ENSGACG00000004450   Transcript: ENSGACT00000005890
Sequence length 166
Comment pep:novel group:BROADS1:groupV:5466348:5479796:-1 gene:ENSGACG00000004450 transcript:ENSGACT00000005890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKIKMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYGHHHQM
MCTPANTPATPPNFPDALTMFSRLRASESFNGGGGSPMAASMATSPPPPQVCGWGVSPNL
PNVPQPPQGLWTHGQPPTQPCPVWPMGVNPHAGAEQKASVAMEAER
Download sequence
Identical sequences G3NKL0
ENSGACP00000005873 69293.ENSGACP00000005873 ENSGACP00000005873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]