SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005875 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005875
Domain Number 1 Region: 22-110
Classification Level Classification E-value
Superfamily UBA-like 3.34e-30
Family UBA domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005875   Gene: ENSGACG00000004446   Transcript: ENSGACT00000005892
Sequence length 1146
Comment pep:known_by_projection group:BROADS1:groupX:6736069:6753817:-1 gene:ENSGACG00000004446 transcript:ENSGACT00000005892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSMGGNRARGSWEQTPGPAQSQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLI
DITGKDQDESMIALHDCNGDVNRAINVLLEGNQDTDSWEMVGKKKGVSGQKDTIQTETGE
DGKENREKGGEKDVARRRGGAPRRGRGATRGREFRGQENGLDGAKAGIAGRGAERGRRGR
GRGRGTIGVSGRRGGRFSAQGMGTFNPADYAEPAQTEESYGGGSTWNNTGSTEPEEGASK
THAGAWRSATEEWGTEDWTEDLSETKIFTASSVASAPVPQENVTITKGQRIDLAVLLGKT
PPSSSSETENPPMEAAQPPSLSQSLVFSNSKQGVSHSQTSSSIPHTQHSMVSMLSKGFGD
VGDAKVASTGTTGSQFLEQYKTAQALAQLAAQHSQTGPPNSTPSSWDTSATSMGPYESFF
SLHFTDMKTQAESAVHSPFTKRQPYQAATSTSSMPQQTSSSHVVPPPASSLPKMAAIPSL
GQQISPSSSDAHGSSPLPLQQHKLKQQKKKASITTKIPALAVEMPCSADITGLNLQFGAL
QFGSEPVLPEYESAPATTTQSSQVQNSLYTSPGRENIYSSEPLGTSTSRSITITVTICSE
STAALSNPSQMDLYDQRAAQTRRYPPSASSSPQKDMQPKVLVNGFNSMQTSQSVEAAAGS
AVSGKPGSDLAPPVSSMGSLVDCGSASMLSASNQTSLSGLGTATSHLQSGPLKQMHHSID
GDSSLHSSSFPSSVSAGPPSAASSSSGAATQVSLGGPQASSVGSATVLAHSGLGPVSSLA
MGLNAASMCVPAAAAAAAAAAASRKPPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYD
DLQMLQTRIPLDYYSIPFATPTTALTGRDGGLTNNPYSGDLSKFGRGDSSSPSPATTLAQ
TQQTQTHHNTQQPFLNPALPPGYSYTSLPYYTGMPGLANTFQYGPAVFPVAPTSSKQHGV
NVGVNASAAAFQQAGGYGSHGYSTGYEDVGQASGSGDFCKGAYGTAVAAAASAQNKPASS
VSGPGVGVSVTSSNTGVPDISGSVYTKTQQSFEKQGFHAGTPAAPFSLPSALGSGGPINP
PAAAAYAPAPFMHILAPHQQPHSQILHHHLQQDGQSGTGQRSQNASIQQKSQINKPAYNS
YNWGAN
Download sequence
Identical sequences G3NKL2
ENSGACP00000005875 ENSGACP00000005875 69293.ENSGACP00000005875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]