SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005914 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005914
Domain Number 1 Region: 299-360
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000221
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005914   Gene: ENSGACG00000004486   Transcript: ENSGACT00000005931
Sequence length 377
Comment pep:known_by_projection group:BROADS1:groupX:6793954:6795878:-1 gene:ENSGACG00000004486 transcript:ENSGACT00000005931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMKSPEKKKARKSTNQAAGFSHLTEFAPPPTPMVDHLVASNPFDDDFGPLSRPSGAGGPS
GAPFLPSPGGGGGYVGGGRMGMGFMGGPAGPGGGQPGRRLPFGPPSNAGPHHQLGFGGMP
GFPPGGPSQFNMPPNFSPPMHPGPGFNPMLSPGSMGGPGGGGPPHPRFGMPPQQQHGQGG
HPFNSPPLPGGGGPRGPPHGPLPPMGGGMGPGMNMMGGMSGGPGGNMPNPNSSPTGPLNG
SGQNSMTNNGGNTPGSNPNPPSNSTSTPNTQSPLPPGPAAPSTGPGSGPGKLGGPGMVFP
CGLCMAEVHDDQDAILCEASCQRWFHRDCTGLTEPAYGLLTRESAAVWACDFCIKTKDIQ
AVFVRQGLGQLVAANES
Download sequence
Identical sequences G3NKQ1
69293.ENSGACP00000005914 ENSGACP00000005914 ENSGACP00000005914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]