SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005969 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005969
Domain Number 1 Region: 40-116
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000374
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 293-338
Classification Level Classification E-value
Superfamily RING/U-box 0.00000153
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 230-266
Classification Level Classification E-value
Superfamily SAP domain 0.0000534
Family SAP domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005969   Gene: ENSGACG00000004524   Transcript: ENSGACT00000005986
Sequence length 345
Comment pep:known_by_projection group:BROADS1:groupI:208356:211604:1 gene:ENSGACG00000004524 transcript:ENSGACT00000005986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFASCCNWLCLDSAADVEPAGGAERRHQSYTNSAFSSQPSPPPEHTCKACGGRLDTPATK
HVCVDCQKDYCCRCSAQLEPRPRLCHTCQRFYGNLLERAELMKLKVKELRDYLHLHEVST
HLCREKEELVELVLGQRSLPSHGSVPETPTSTPPDVTSDPTICISSPTPDSPTSIPEPPS
AEAPPPPTEEPAPAEPNAADEDQSGSELGSGGGPVSGRRASLSDLSCPDDIEGLSVRQLK
EILARNFVNYKGCCEKWELMERVNRLYQDQQNLLAANAVNSSESGGVGGSPGQEENLCKI
CMDCPIDCVLLECGHMITCTKCGKRMSECPICRQYVVRAVHVFRS
Download sequence
Identical sequences G3NKV6
ENSGACP00000005969 ENSGACP00000005969 69293.ENSGACP00000005969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]