SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006005 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006005
Domain Number 1 Region: 33-270,302-326
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.93e-64
Family BAR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 565-657
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.8e-43
Family Ankyrin repeat 0.0000278
Further Details:      
 
Domain Number 3 Region: 419-519
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.8e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.0000221
Further Details:      
 
Domain Number 4 Region: 293-410
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-21
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 5 Region: 930-1004
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-17
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006005   Gene: ENSGACG00000004538   Transcript: ENSGACT00000006022
Sequence length 1006
Comment pep:known_by_projection group:BROADS1:groupXXI:9930390:9962816:-1 gene:ENSGACG00000004538 transcript:ENSGACT00000006022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQISVSEFLSETTEDYNSPTTSSFTTRLQSCRNSVNVLEEALDQDRTSLQKVKKSVKA
IYSSGQDHVQNEENYAQALDKFGGNFISRDNPDLGTAFVKFSSLTKELSALLKNLLQSLS
HNVIFTLDSLLKGDLKGVKGDIKKPFDKAWKDYEAKFTKIEKEKREHAKQHGMIRTEITG
AEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGGALLQNLIKYYHAQCNFFQDGLKTADK
LKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKEDSQSKQGGYSMHQLQGN
KEFGCEKKGYLLKKSDGLRKVWQRRQCSVKGGMLTISHATSNRQPVKLNLLTCQVKPSTE
DRKCFDLISHNRTYHFQAEDEQEFVIWISVLTNSKEEALNMAFRGEQSSGGEDGLEDLTK
AIIEDVLRMPGNEVCCDCGASDPKWLSTNLGILTCIECSGIHREMGVHISRIQSMELDKL
GTSELLLAKNVGNSSFNEIMEGNLTSPTPKPTPSSDICKNKSKCTGHIILRVYSFTSSFK
TASRENGCCPRPSHRVFAVFDGPLQESGETALHYSVRTADQTSLHLVDFLVQNSGNLDKQ
TEWGNTALHYCSMYEKPECLKLLLRGKPATDITNQNGETALDVARRLRNTQCEEALIIIT
RTDSRLLXQTAAPVLQRLHQPDVQRLHRPHLLPRGRRAAAATQEPGQSPAVECNLSTPAS
EGGVQSAPHLAFLGSHSHYATLAGTRPYISEYPGFLFSPLLRPRAPCTLRSPSLLYSSRL
HGGGVYLTPLWLSSLLAASILLFSLIIEQPSVVLVAPPLHVSSSCIAPPAPPPSGPPSTL
TPGGSSTLSKKRPPPPPPGHKRTLSDPPSPLFHSPHSKGGLTGEVFQKSPPASDPPQKAP
PADRPQPGDLPPKPQPSELPPKPGELPPKPQLSDLPPKPQLGKSKTRRVKTIYDCQADND
DELTFVEGEVIIVTGEEDQEWWIGHVEGEPDRKGVFPMSFVHILSD
Download sequence
Identical sequences G3NKZ2
ENSGACP00000006005 ENSGACP00000006005 69293.ENSGACP00000006005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]