SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006025 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006025
Domain Number 1 Region: 970-1179
Classification Level Classification E-value
Superfamily SET domain 1.57e-71
Family Histone lysine methyltransferases 0.0014
Further Details:      
 
Domain Number 2 Region: 857-982
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.03e-26
Family PWWP domain 0.00003
Further Details:      
 
Domain Number 3 Region: 212-354
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.99e-21
Family PWWP domain 0.005
Further Details:      
 
Domain Number 4 Region: 808-874
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000443
Family PHD domain 0.0045
Further Details:      
 
Domain Number 5 Region: 1193-1268
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000288
Family PHD domain 0.0048
Further Details:      
 
Domain Number 6 Region: 651-701
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000554
Family PHD domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006025
Domain Number - Region: 702-750
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.036
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006025   Gene: ENSGACG00000004554   Transcript: ENSGACT00000006042
Sequence length 1355
Comment pep:known_by_projection group:BROADS1:groupXV:688058:695635:1 gene:ENSGACG00000004554 transcript:ENSGACT00000006042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKGSSLPTMPEPANPISMKQPPESLGVRQAGGDMSGDPALLMMDKAAAQLAATLQDGV
LQKMAGHSHNNHGHERLKDLTSRVLNGDQDALPKLCAPEPPMFKGAEAPATNGTHQHTCS
PHADHEHKATIPQVVQQPAFEPRCANGTSLSTATEDAVSAMEPERLMRFFFYSYFKETKV
LYFIPLISSLLQPDFPPPLKGVDPREESAAVVGFSVGDLVWTKVAGYPWWPCMVTTDPEF
NNHVKQKQKAANSRMGPLYHVQYFGDAPERGYIFEKNMVTFTGEDQYQELRQGRQQPASR
VVLKRTAPSVPRKLQAQWNMGVIQAKEACGMSLDERMGNFAFLYDDDGPHLNPCILEKSP
KKALRRGKRHKDAEQNSARENIGERAKAIEAETVVPEKKKRRPRQAASPAKTVGRRNNTS
EPVKKRKPKVASLTADVTEPVPLPLSGWFPVKSPALNGHMWLVKRQRGFIVVEQLYSRGS
ERRRLQRTKLSSLKRDVKQAKKLKHRSKSPNESLTLSEVWNGVKYQHQMDNKHIVDSSEG
TDKKQRRQKPDGDSKEPKKKKKTTAKLKALLPGKPRAPTSSSKLFVFTENQDAEKPERSR
KRKQDGGNASAPSTAKRRRLTPCPEPEGSGSEGRPDSPSDSLDGTKKGDRKKEFVCQTCE
QAGDDLVPCEGQCCGMFHLRCLGLSLKPDEKLLCQECSSGVHSCFTCKQSEGAVRRCHVP
HCGRFYHEACIRLSPLTVFDNKGFRCPLHACLSCHYGCRSKQRSTKGRLTRCLRCPVAYH
AGDPCVAAGSEMVTSTAIICTNHFNAKKGYSHHSHVNVSWCFVCSKGGQLLCCESCPAAF
HPDCLNIAMPDGSWFCNDCRAGKKPKYRDIIWVKLGKYRWWPAEIHHPRNIPTNIQHLRH
EIGEFPVFFFGSKDYFWTHQGRVFPYMEGDRGSKHQKTGIGKVFKNALLEAEARFKQIKL
KREAKEAQENSRKPPAYKFIKVNKPVGKVHVYTADVSEIPKCNCKPADERPCGFESECLN
RMLQYECHPQVCPSGARCCNRDFTKRLYPETKIIKTPGKGWGLISLRDVKKGEFVNEYIG
ELVDEEECRARIKYAHENNISDFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETQKWT
VNGDTRVGLFAVRDIPAGTELTFNYNLDCLGNEKTVCRCGAPNCSGFLGDRPKNSSSQTA
EAKAKRSKRKYRRRKAEGQKKSDDDCFRCGDGGQLVLCGKKTCSKAYHLYCLNLNKRPFG
RWDCPWHHCDVCGKNSEAFCQLCPNSFCKAHQEGALRSWPPTGQLCCLEHEEQPEGPGAP
DPGAVIAALQATPPAPDAGSRPAKSSRKAGGVEGK
Download sequence
Identical sequences G3NL12
ENSGACP00000006025 69293.ENSGACP00000006025 ENSGACP00000006025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]