SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006064 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006064
Domain Number 1 Region: 534-607
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000023
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006064   Gene: ENSGACG00000004577   Transcript: ENSGACT00000006081
Sequence length 711
Comment pep:known_by_projection group:BROADS1:groupXX:2462673:2521586:-1 gene:ENSGACG00000004577 transcript:ENSGACT00000006081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSEDAAVEGLSLEEILRLYSQPINEEQAWAVCYQCCRTLAREHRSRGSSSAAGASSAA
APRKITGPEDVRIQRDGSVSLQQRDREDWLTKPPLGSNTDVIESLGIMIYKALDYGLKEN
EERELSPPLEQLIDLMTNMAEAERDACPDEGYEATEEEDEAEDDAGNICSVPGYRDIFKL
CTAHLPALSDTPTHYQAVCRALYTETKELGTFLEKIRSAKENLRKMEDGPSGDPGRDLNE
LQNADWARFWVQVMRDLREGVKLKKVQERQYNPLPIEYQLTPYEMLMDDIRSKRYKLRKV
MVNGSIPQRLKKSAHEVILDFIRSRPPLNPVSARKLKPQTELPPTLHERILKEIKSERKL
RPVSPGEVRRGMLGKGPLKCDINLPALEIKQTGCNNRAEPSGSQSVPPRKRLLKAPSLAE
LDSSDSDDASLSHFYLSPLHEPQLPPRSCPSPLRPSQRDGRRPSGDTPSRRRLRPMCDCF
SRPPRRTPTYVSHNGNCRRVDSLSKLCMIDGLAAVSDRCVSLQEEFCFPVECLSLTVEEV
MHIRQVLVKAELEKFQQYKDIYNAMKKGKLCFCCRSKRFSFFTWSYICQFCKKPVCAQCC
KKMRLPSKPYSSLPIYSIGSTNTLPRERSLHSMEEKKFSKHGSLKSHEELELPSELTEDW
ATMEVCVDCKKFITDIIASSKHSLSLATKRARLKRKTQSFYLSSPKAINFP
Download sequence
Identical sequences G3NL51
ENSGACP00000006064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]