SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006076 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006076
Domain Number 1 Region: 529-602
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000015
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006076   Gene: ENSGACG00000004577   Transcript: ENSGACT00000006093
Sequence length 730
Comment pep:known_by_projection group:BROADS1:groupXX:2463262:2494377:-1 gene:ENSGACG00000004577 transcript:ENSGACT00000006093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGLSLEEILRLYSQPINEEQAWAVCYQCCRTLAREHRSRGSSSAAGASSAAAPRKITGPE
DVRIQRDGSVSLQQRDREGRDMLFLTNKINNQCFETWVIESLGIMIYKALDYGLKENEER
ELSPPLEQLIDLMTNMAEAERDACPDEGYEATEEEDEAEDDAGNICSVPGYRDIFKLCTA
HLPALSDTPTHYQAVCRALYTETKELGTFLEKIRSAKENLRKMEDGPSGDPGRDLNELQN
ADWARFWVQVMRDLREGVKLKKVQERQYNPLPIEYQLTPYEMLMDDIRSKRYKLRKVMVN
GSIPQRLKKSAHEVILDFIRSRPPLNPVSARKLKPQTELPPTLHERILKEIKSERKLRPV
SPGEVRRGMLVIRPPCMSLSFDASDEFSPYMGRRTSSSLSLANGSACSRAEPSGSQSVPP
RKRLLKAPSLAELDSSDSDDEIFGHRSASSSSVATSMMDDTSPECALGKKTPPSFLPISS
TPQPERRQTPQRRHSIEKETPTNVRLFQPPSKKNSKSLEEFCFPVECLSLTVEEVMHIRQ
VLVKAELEKFQQYKDIYNAMKKGKLCFCCRSKRFSFFTWSYICQFCKKPVCAQCCKKMRL
PSKPYSSLPIYSIGSTNTLPRERAAAKSEKSTSSPQRHGIHKTMSKFSKHGSLKSHEELE
LPSELTEDWATMEVCVDCKKFITDIIASSKHSLSLATKRARLKRKTQSFYLSSPKGREEY
RPSERTIKEI
Download sequence
Identical sequences G3NL63
ENSGACP00000006076 ENSGACP00000006076 69293.ENSGACP00000006076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]