SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006081 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006081
Domain Number 1 Region: 383-456
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000106
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006081   Gene: ENSGACG00000004577   Transcript: ENSGACT00000006098
Sequence length 584
Comment pep:known_by_projection group:BROADS1:groupXX:2463262:2484867:-1 gene:ENSGACG00000004577 transcript:ENSGACT00000006098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNMAEAERDACPDEGYEATEEEDEAEDDAGNICSVPGYRDIFKLCTAHLPALSDTPTHY
QAVCRALYTETKELGTFLEKIRSAKENLRKMEDGPSGDPGRDLNELQNADWARFWVQVMR
DLREGVKLKKVQERQYNPLPIEYQLTPYEMLMDDIRSKRYKLRKVMVNGSIPQRLKKSAH
EVILDFIRSRPPLNPVSARKLKPQTELPPTLHERILKEIKSERKLRPVSPGEVRRGMLDE
FSPYMGRRTSSSLSLANGSACSRAEPSGSQSVPPRKRLLKAPSLAELDSSDSDDEIFGHR
SASSSSVATSMMDDTSPECALGKKTPPSFLPISSTPQPERRQTPQRRHSIEKETPTNVRL
FQPPSKKNSKSLEEFCFPVECLSLTVEEVMHIRQVLVKAELEKFQQYKDIYNAMKKGKLC
FCCRSKRFSFFTWSYICQFCKKPVCAQCCKKMRLPSKPYSSLPIYSIGSTNTLPRERAAA
KSEKSTSSPQRHGIHKTMSKFSKHGSLKSHEELELPSELTEDWATMEVCVDCKKFITDII
ASSKHSLSLATKRARLKRKTQSFYLSSPKGREEYRPSERTIKEI
Download sequence
Identical sequences G3NL68
ENSGACP00000006081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]