SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006110 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006110
Domain Number 1 Region: 8-118
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000765
Family Phosphotyrosine-binding domain (PTB) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006110   Gene: ENSGACG00000004630   Transcript: ENSGACT00000006127
Sequence length 245
Comment pep:known_by_projection group:BROADS1:groupXVII:2520134:2521465:1 gene:ENSGACG00000004630 transcript:ENSGACT00000006127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEAPVRDDGAVTVSAEYVGSFPVDDRCLDDQMKLLHTQLKSLRACDRRRPVSLKFSVKG
VKMYDEDETTLLMAHALRRVSLSTARPVDAQFAFISHNPGRADGQLYCDLYRARHSRAAS
SVNRRPSRRRSAARAAPPPLFKTGSRAFFFSARCAPPTLLLPFAGAVPETENHKSSDELP
SESFPTSSPSLVRKKAMRTKGLRSGAYRSFTFTPLRQRSVQWHLRGSPGGQSIQRALSRV
KELFR
Download sequence
Identical sequences G3NL97
69293.ENSGACP00000006110 ENSGACP00000006110 ENSGACP00000006110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]