SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006114 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006114
Domain Number 1 Region: 139-334
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.55e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.000000114
Further Details:      
 
Domain Number 2 Region: 72-133
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.68e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006114   Gene: ENSGACG00000004616   Transcript: ENSGACT00000006131
Sequence length 334
Comment pep:known_by_projection group:BROADS1:groupXVI:9964094:9973198:1 gene:ENSGACG00000004616 transcript:ENSGACT00000006131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRESYEVHKVEKSLVQKAKREANQEDILVAALGMRMGPQKPPATFWQPLKLFAYSQLT
SLVRRATLKESERTPKSEKVHNFKVHTFRGPHWCEHCASFMWGLMAQGVKCADCGLNVHK
QCSSLVPNDCKPDLRHIRKVYSCDLTTLVSAYNTARPMVVDMCIREIESRGLKSEGLYRI
SGFSDLLEEVKVAFDKDGEKTDISVNAYEDINIITGALKLYLRDLPDPIISYDAYPRFIE
AAKLTDPDKKLEAFREALALLPPSHSETLKYLMAHLKRVTQNEKFNLMNAENLAIVFGPT
LMRAPNLDAITALNDIRHQRQVVEVLIKKEDVLF
Download sequence
Identical sequences G3NLA1
ENSGACP00000006114 ENSGACP00000006114 69293.ENSGACP00000006114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]