SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006122 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006122
Domain Number 1 Region: 4-221
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-59
Family DBL homology domain (DH-domain) 0.0000171
Further Details:      
 
Domain Number 2 Region: 207-352
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-31
Family Pleckstrin-homology domain (PH domain) 0.00054
Further Details:      
 
Domain Number 3 Region: 369-483
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-31
Family DEP domain 0.0035
Further Details:      
 
Domain Number 4 Region: 467-598
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-28
Family DEP domain 0.0016
Further Details:      
 
Domain Number 5 Region: 582-667
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000067
Family PDZ domain 0.025
Further Details:      
 
Domain Number 6 Region: 656-733
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000776
Family PDZ domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006122   Gene: ENSGACG00000004620   Transcript: ENSGACT00000006139
Sequence length 1605
Comment pep:known_by_projection group:BROADS1:groupXII:4145929:4203595:1 gene:ENSGACG00000004620 transcript:ENSGACT00000006139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATKDSDRQQRLRLCVLNEILNTERDYVRTLLFLQSAFLQRIRQTAEDQQCLSPEHVKILF
SNIEDILELHKEVLSAVEASLQPDPHPQHALGHVFLQFKRSFSVYGEYCSNHEKALRLLV
ELNKIPNIRTFLLHCMLLGGRKSTDVPLEGYLLSPIQRICKYPLLLKELLKRTPKKHTDY
PAVEEALQAMKAVCSNINETKRQMEQLEALEQLQSHIEGWEGTNLTDICTKLLLHGNLLK
ISAGNIQERVFFLFDNLLVYCKRKSRVSGKKSSKRTKSMNGPLYVFRGRINTEVMEVENV
EDGTADYHSNNYTVTNGWKIHNTAKNKWFVCMTKHAEDKQKWLDAILREREQRECLKLGM
ERDAYVMIAEKGEKLYHMMMTKSRHLIKDRRRKLSIVPKCFMGNEFVSWLIDSGEISNPD
EGVNLGQALLENGIIHHVSDKHQFKNEQVLYRFRYDDGTYKARSEMEDIMSKGVRLYCRL
HSLHTPVIKDRDHHLKTFKSVVPASKLVDWLLLQGDCSTREDAVTLGIGLCNNGFMHHVL
EKSEFKDESQFFRFYADEEMEGTSTKSKQLQRNDFKLLENILAKSLVIHPEEEDYGFEIE
EKNKAIVVKSVTRGSHAEMAGLQVGRKIFTINEDLLFLRPFSEVETMISQAFCIRRSLRL
LVATKAKEIVKIPDNPDSLSFRLCGSAPPHVHAVRKGWEAAGSGLQPGQVVLKVNGNNVN
HSDYQEALEHFAAQHTHQDPPQACHWVYRTFEDVEELQIRIQRRTVRTPRGRTAPMEQVK
NNVYDHRLGRLSLCDELPLVSVTVDNVHLEHGVVYEYVSTAGIKSHVLEKMVEPKGCFSL
TAKILEAFSGDDSLFVRNCSQLISQSDRVITMPQYEFRQICDSKLESIRRRISSYNQFAL
ELRNKAWPSFRQAGVRPHPLGCMDFVPTNCHVNFMQVSYPKSTTSAGRTFSIRFGRKNSL
FGMDLDQAQLNPMSHTQHCVTSMGAPSWSCSGLVDGGDGSTEGGLSFLLKQEDTETQDAY
IHLYSRLDVAVREMRQYVAQIDVLLSSITEPTQLQGEGGEPPAYEPSQPPSLAPSDDAVD
QDKVEQGGIKRVCFKVNEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGS
DEMGSGDELPCDMRISSDKQDKLHGCLEHLFNQVDSINCLLKGAVMSKACEETKHFYSDH
TQPEFRQTEDWTVRCRHIIHKNIQEDPWNLPSSIKTLVESLQRFVDDGKNQLLLALLKCT
DTSLQLRRDVIFCQAATGALCTLAEQLLAALRSRFNNAGEYQEDGKETSRKWLEQISVIG
VLLHFQSTLAPHLKEERTMLEDTKAALLDLDKVTVFFRQLEDECLVANTPVCYQVEGSRQ
ALRVTLYLDSCHFSELPTRLQNGGSLKLQTVLFTRALERPEGVSQHDYAAMEEFQQRTNA
VSLEKVKAYYRRLRAFYLEKSNLPTDSNTTAMKIDQLLRPLNTLDDLCRLMQSYVNVRPS
AQGHPSGVSVLCVSSELCNRLGACHITMCGTGMQRCSLNVTLEQAMILARNHGLMPRCTM
QTMDIMRKQGARVELSAKNLKVMDQMPPSFPRLFKLCLPPSDGDF
Download sequence
Identical sequences G3NLA9
69293.ENSGACP00000006122 ENSGACP00000006122 ENSGACP00000006122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]