SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006124 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006124
Domain Number 1 Region: 548-760
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-51
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 231-375
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-44
Family Third domain of FERM 0.00056
Further Details:      
 
Domain Number 3 Region: 895-1039
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-35
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 4 Region: 745-867
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-30
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 5 Region: 130-233
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-27
Family Second domain of FERM 0.0000793
Further Details:      
 
Domain Number 6 Region: 50-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.63e-17
Family First domain of FERM 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006124   Gene: ENSGACG00000004623   Transcript: ENSGACT00000006141
Sequence length 1052
Comment pep:known_by_projection group:BROADS1:groupVIII:3154504:3175974:-1 gene:ENSGACG00000004623 transcript:ENSGACT00000006141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLEGSYRALQTPGVRLGAQFNPGVSTLEPGHSLGGTPAGRSPGRELQIRVQGLDDSQE
FFNVDTKALGQYLLSEVFLRGNLIERDYFGLEFQNLQMNWAWLEPTKPIVRQVRRPANAL
FRLSVKFFPPDPGQLQEEYTRYLFSLQMKRDLMESRLICTENTGALLASHLVQSEIGDYD
DAADRDFLKSTQLLPYQEKVQERIMELHRRHLGQTPAESDFQILEIARKLEMYGVRFHPA
ADREGSKINLAVAHMGLQVFQGNTKINTFNWSKIRKLSFKRKRFLIKLYPEVHGPHQDTL
EFLMASRDQCKIFWKICVEYHSFFRMFDQPQPKSKAILFTRGSSFRYSGRTQKQLVDYVR
ESGAKRTPYQRRNSKVRMSARSLATDVPKQSLSFNDSLCAPGSASSATVSFSRCQSILHP
PDIFMFSTLFLSNKNPQASQKKNAGGDGGGGAVAGGTTIWVGVLCRPSLSICGPTCLRPL
AGFCSNSPQASPVSSKGPLCLSPSFQMSTLSLPGQNPSPLQSPVLGEGGSNPRLEEEEEG
RRKRYPTDKAYFIAKEILTTERTYLKDLEVITVWFRSAVIKENAMPEVLMNLLFSNIDPI
YEFHRGFLKELDQRLALWEGRSNAHVKGDFQRIGDVMLGNMCALKEFTGFLQKHDEVLTE
LEKASKRLKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPAHRDH
DDCKEALKEVAEIAAQLQSSLIRLENFQKLTELQRDLIGIENLTGPGREFIREGCLYKLT
KKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLHGMIVEESENEWSVPHCFTIYSA
QRTVVVAASSRVEMGKWIEDLNLAIDLAKKSQEKSSIFLDAGLGDHSNRSSDEVSLEQES
EDDMNSSHTSLDKQTHHRANTTMHVCWHRNTSVSMSDHSQAVENQLSGYLLRKFKNSNGW
QKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPDETDGIHKDYVFKLQFKSHVYFF
RAESEYTFERWMEVIKSAASTTGRMSLLVPKG
Download sequence
Identical sequences G3NLB1
ENSGACP00000006124 69293.ENSGACP00000006124 ENSGACP00000006124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]