SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006147 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006147
Domain Number 1 Region: 137-236
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000646
Family UBX domain 0.023
Further Details:      
 
Domain Number 2 Region: 14-48
Classification Level Classification E-value
Superfamily UBA-like 0.00000223
Family UBA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006147   Gene: ENSGACG00000004661   Transcript: ENSGACT00000006164
Sequence length 237
Comment pep:novel group:BROADS1:groupXXI:10016515:10018952:-1 gene:ENSGACG00000004661 transcript:ENSGACT00000006164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSASPPTIGELFLILGEMGFSEEQIQAAVQAGHFSVSDAADWLLQGQYPRHKLVKRTSQ
PAETAISAFNLPKEAASTSETHTSPSDSRASPSLLLRPSQSGNLSPDPLPVESRIKPDKS
DFEEQQRHRVAQEARAERRQKKQERESVLKRIAEDRRSLQQKKQTSAAAETSAPSGEGQK
LGGQTRTNVDNNCVLMIRLPSGESMRERFPADAPLRSVVEHIAGRHPSLPSFSLLQG
Download sequence
Identical sequences G3NLD4
ENSGACP00000006147 69293.ENSGACP00000006147 ENSGACP00000006147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]