SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006201 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006201
Domain Number 1 Region: 317-483,882-1061
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1e-119
Family Mammalian PLC 0.00000841
Further Details:      
 
Domain Number 2 Region: 634-748
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-30
Family SH2 domain 0.00000648
Further Details:      
 
Domain Number 3 Region: 522-633
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-26
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 4 Region: 1078-1200
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.79e-25
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 5 Region: 781-846
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-19
Family SH3-domain 0.000076
Further Details:      
 
Domain Number 6 Region: 29-145
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-18
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 7 Region: 155-310
Classification Level Classification E-value
Superfamily EF-hand 0.00000000012
Family Calmodulin-like 0.037
Further Details:      
 
Domain Number 8 Region: 472-518
Classification Level Classification E-value
Superfamily PH domain-like 0.0000659
Family Pleckstrin-homology domain (PH domain) 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006201   Gene: ENSGACG00000004688   Transcript: ENSGACT00000006218
Sequence length 1281
Comment pep:known_by_projection group:BROADS1:groupVIII:3202128:3218830:-1 gene:ENSGACG00000004688 transcript:ENSGACT00000006218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEGAAGGPAGSPGPATASRALDWTEAGPRILHSLEMGTVMTLFYQKKSQRPERRTFQIKQ
DMRQIVWGRNPEKVEGEVDIREIRELRLGKGSRDFERYPEEARKLDTAHCFIVLYGLEFR
LKTLSVAAFSEEEVNMWITGLNWLMMDTQRAPAPQQIDRWLRKQFEAMDRTHEGSITVKD
VKGLLPQVNYRVPNTRFLKDKLQEVEARSDLSYPNFSQLYRTLMFDAQKTLELSFPLRNV
DRPELCQISLYDFQKFLQMDQKESWAADLSRVREFLAGYTRGGPQPEPMLQLDEFLTFLF
SKENSVCDPRLSPVVADDMKRPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRC
IELDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIKEQAFVTSDYPVILSIEDHCSVVQQR
NMATHFKKVFGDLLLTKPVDNNAEELPSPYQLRRKILIKHKKLVEGTLYEEVSSASYSEN
DISDSLKNGILYLEDPIDHTWTPHYFVLTSNKIYYSEETSHYQTVKDEECNNNEQHCAER
WFHGKLGGGRDGRQVAEKLLQEYCEGGAKDGTFLVRESETFVGDYTLSFWRSGRVQHCRI
HSRQESGSTRFYLTDNLVFDSLYRLICHYRDTPLRCNEFEMRLGGPVPQPNAHESREWYH
SSLSRVQAEHMLMRVPRDGAFLVRKRSENHSYAISFRAEGKIKHCRIQQEGRLFMLGSSA
EFESLVDLVSYYEKHPLYRKMRLRYPINEDTLDRMGTAELDYGALYEVRSPHFYVEANKM
PSARCTVKALYDYRAQREDELCFPKQALVTNVDKQEGSWWRGDYGGKKQLWFPANYVEEV
PSSPTREMDDACQSTENSPLGTFLKGFIDVPTCHVGESRRTDTRLAPSSSLSSPPGQNLD
VGADSAEEVTRWVGKIRAAAQKAHARMPGEKQMERRKKIAVELSELVIYCRPVPFNEDKI
GTERAWYRDMSSFPETKAEKFATRSKGKRFLQYNRRQLSRVYPRGQRLDSSNYDPLSMWL
CGSQLVALNFQTPDKPMQLNQALFMLGGASGFVPQPDVMRDEAFDPFDKDTLRVEPITVQ
LQVLGARHLPKNGRSIVCPFVEVEICGADYDGCKCKTDVVADNGLNPVWLQKQFVFDIHN
PTFSFLRFTVFEEDMFSDPNFLAQATYPVRLLRTGYRSIPLKNSYSEELELASLLVHVEI
VNAKPWPQEEDDENMYMTIQRLRDRTSELSNQVSLLERSGSGDLGYQQSLEELRAAQDQL
SELADGEEKKRETEAAGDSKA
Download sequence
Identical sequences G3NLI8
69293.ENSGACP00000006201 ENSGACP00000006201 ENSGACP00000006201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]