SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006226 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006226
Domain Number 1 Region: 390-481
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-29
Family DEP domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 221-330
Classification Level Classification E-value
Superfamily PDZ domain-like 2.13e-23
Family PDZ domain 0.0000577
Further Details:      
 
Domain Number 3 Region: 3-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 3e-20
Family DIX domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006226   Gene: ENSGACG00000004718   Transcript: ENSGACT00000006243
Sequence length 557
Comment pep:known_by_projection group:BROADS1:groupI:436490:448294:1 gene:ENSGACG00000004718 transcript:ENSGACT00000006243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEETRVIYHLEDQETPYLIRINVPAQRVTLADFKHVLNKPNVKFFFKSVDDEIGVVKEE
ISDEDAILPFVNGRVICWLVSSETCPLDFRGSDLQSLATPTGPAPPPIERTGVIGDSRPP
SFQIIIGRYASPLEHDNTTIISADISHAHQRPAGENGAGPVAGGDRSSTQPSSQLETSSF
CSSEEDSGGRFSQSTGQSSSSPKLIRTQRRRHKKPKTPQRMESVSFSSVTDSTMSLNVIT
VTLNMAERYNFLGISIVGQSNERGDGGIYIGSIMKGGAVASDGRIEPGDMLLQVNNINFE
NMSNDDAVRVLREIVHKPGSVTLTVAKCWDPSPRGCFSLPRSEPVRPIDPAAWVSHTAAM
TGRLPPHYGETSISPPTAPRSPSVHEENHLTIHSEMTAVVKAMANPESGLEVRDRMWLKI
TIPNAFIGSDVVDWLHRSLEGFTDRREARKYAGSLLKAGFIRHTVNKVTFSEQCYYIFRD
LCGDLCEMTVLDHEEPSSRGGGSDCDPLGPAPGPQRPPAFPYQYPIPHPYSSPPPLHQLP
VWGGGGGGSQPSEGDIS
Download sequence
Identical sequences G3NLL3
ENSGACP00000006226 69293.ENSGACP00000006226 ENSGACP00000006226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]