SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006259 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006259
Domain Number 1 Region: 54-303
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-87
Family Protein kinases, catalytic subunit 0.0000156
Further Details:      
 
Domain Number 2 Region: 671-782
Classification Level Classification E-value
Superfamily KA1-like 1.64e-44
Family Kinase associated domain 1, KA1 0.00000613
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006259
Domain Number - Region: 301-360
Classification Level Classification E-value
Superfamily UBA-like 0.0668
Family UBA domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006259   Gene: ENSGACG00000004742   Transcript: ENSGACT00000006276
Sequence length 782
Comment pep:known_by_projection group:BROADS1:groupXV:862018:885408:1 gene:ENSGACG00000004742 transcript:ENSGACT00000006276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKTPLPTVNEKVTESHTSHSNGRQEVSVRSARTGVRSRGSEEPQQPHVGKLLLKTIGK
GNFAKVKLRHILTGREVSAHSLDRDEMTPLSLSELFREVRIMKILNHPNIVKLFEVIETE
RTLYLVMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKHIVHRDLKAENLL
LDADMNIKIADFGFSNEFTMGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYT
LVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPSKRGTLEQIMKDR
WINAGFEEDELKPYIEPELDITDQKRIDVMVGMGYNLEEIQESLAKMKYDEITASYLLLG
RKASEMEPSESASSSNLSLAKARPSSELNGQSPSHLKVQRSVSSNHKQRRYSEQVGQNVP
PGMSHPKRSPTTTAENSAKEEGGVQMRKPSAPPASPLLGNANNPNKADIPDRRKGATTGP
SSNAAAAAAMTRRNTYVCSDRNNGDRLSVIPNGKENSPSSGFAGAAFGASSGSVRLRYQN
AGPAGWATLPHSYYALDYCSPNFYLISHPDQRNPVASINSIANASTPDRLRFPRGTASRS
TFHGGQLRDRRTATYNGPPASPTLSHDATPLSQTRSRGTSNLFSKLTSKLTRRVSTEFER
NGRLEGSSRHVPGDQKGENKDGKPRALRFTWSMRTTSSMEPCDIMREIRKVLDANNCDYE
QQESFLLLCVHGDGRAENLVQWEMEVCKLPRLSLNGVRFKRISGSSIAFKNIASKVANEL
KL
Download sequence
Identical sequences G3NLP6
ENSGACP00000006259 69293.ENSGACP00000006259 ENSGACP00000006259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]