SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006309 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006309
Domain Number 1 Region: 1033-1134
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-24
Family PDZ domain 0.00058
Further Details:      
 
Domain Number 2 Region: 880-982
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-24
Family PDZ domain 0.00018
Further Details:      
 
Domain Number 3 Region: 414-525
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-24
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 759-855
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-21
Family PDZ domain 0.00057
Further Details:      
 
Domain Number 5 Region: 612-704
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-18
Family PDZ domain 0.00031
Further Details:      
 
Domain Number 6 Region: 127-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000413
Family Nucleotide and nucleoside kinases 0.0065
Further Details:      
 
Domain Number 7 Region: 288-325
Classification Level Classification E-value
Superfamily WW domain 0.000000000000371
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 9-110
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000263
Family PDZ domain 0.038
Further Details:      
 
Domain Number 9 Region: 334-368
Classification Level Classification E-value
Superfamily WW domain 0.0000531
Family WW domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006309   Gene: ENSGACG00000004771   Transcript: ENSGACT00000006326
Sequence length 1157
Comment pep:known_by_projection group:BROADS1:groupXVII:2693302:2779201:-1 gene:ENSGACG00000004771 transcript:ENSGACT00000006326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRTLKKKKHWSGKVVECAVSWGNLGDFGTVVEVLGGAELGQFPYLGQMKLDVLACHVGK
LPYYGDVLLEVNGTPVSGLTNRDTLAVIRHFREPVRLKTVKPGKVLNTDLRHYLSLQFQK
GSLDHKLQQIIRDNLYLRTIPCTTRLPRETEVPGVDYNFITLGDFRILEESGLLLESGTY
DGNYYGTPKPPAEPNLVQPDLVDQVLFDEDYGGEIPRKRTTSVSKMDRKDSAVPEEEDDD
ERPPLVNGLPDLGAEHKEGAHWRKAVPSYNQSSSAMDFRTWSSLPRDDSLEPLPLNWEMA
YTETGMVYFIDHNTKTTTWLDPRLAKKAKPPEKCEDGELPYGWEEIDDPQYGTYYVDSNS
LKATVVSPHKMGGNAGFHQSHINQKTQFENPVLEAKKKLSQETAVIQQAAAAPSQGKGGA
FGFTSDPSELQGELYHTALKKSSQGFGFTIIGGDRTDEFLQVKNVLADGPAAHDKKMASG
DVIVEINGISVLGKTHPEVVQMFQSIHINQYVDMVLCRGYPLPPDVDLNSDDPLPPPPLP
PATQPPAAALHGGEVVTAVPLINGQPLLVKGDVLHGSSQELHYVTTDASGRPVVAALPNG
RHGERGESAAGTLQPELVSVPLIKGPGGFGFAIADCPLGQKVKMILDAQWCRGLQKGDVI
KEINGQNVQTLSHAQVVDILKDFPVGSEVNVLVLRGGQTSPVKSLRPRQEMTTSTETLDG
TADSAPQALPYHSNTSTLRSAGSPKREATEMYLKSKALLESRQPHTKDIDVFLKRDIETG
FGFRVLGGEGPQQPVYIGAIVANGAAEKDGRLRAGDELIGIDGVMVKGRSHKQVLDLMTN
AARNGQVMLTIRRKIIYRDATEEEALEMAPVLVNGSPKLPRLPMPSALDHESFDITLHRR
DSEGFGFVILTSKSKPPYGVIPHKIGRIIEGSPTDRCGLLHVGDRISAVNGRSIIELSHN
DIVQLIKEAGTVVTLTVVPEDEYKGPPSGASSAKQSPALQHRAIGPRSALQEERCNLELE
EKREGVDWSEHRSLSLSEQGTMCVTGPNQGCLTVELERGPRGFGFSLRGGTEYNMGLYIL
RLAEDGAAQLDGRIHVGDEIVEINGEPARGISHTRAIELIQAGGSKVAVLLRPGAGLAQD
GGGSASSTACYYTEHQH
Download sequence
Identical sequences G3NLU6
ENSGACP00000006309 69293.ENSGACP00000006309 ENSGACP00000006309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]