SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006345 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006345
Domain Number 1 Region: 1041-1298
Classification Level Classification E-value
Superfamily PP2C-like 6.41e-42
Family PP2C-like 0.0019
Further Details:      
 
Domain Number 2 Region: 721-1030
Classification Level Classification E-value
Superfamily L domain-like 3.2e-41
Family Leucine rich effector protein YopM 0.013
Further Details:      
 
Domain Number 3 Region: 509-754
Classification Level Classification E-value
Superfamily L domain-like 5.19e-37
Family Internalin LRR domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006345
Domain Number - Region: 428-505
Classification Level Classification E-value
Superfamily PH domain-like 0.00564
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006345   Gene: ENSGACG00000004794   Transcript: ENSGACT00000006362
Sequence length 1564
Comment pep:novel group:BROADS1:groupVIII:3236623:3248419:-1 gene:ENSGACG00000004794 transcript:ENSGACT00000006362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSMLSRRRQRHKRNLSLGAPPTSGSPGASSGEAAGPAPAASPLSTLSLDRKTFLRQKQSK
QLQASDKTWVRSDSRRGCIHVHDWLTPSYPRPVLCTVDTTAAEVAGRLGGSKAGAVLRIH
GRTAAVVDPSDRCEATDGHPDDTGAEVKPPEAEDSDKTASNSSSEVYLNDIGVDLSLSAA
DSYGAYSGSDMESSTCDDFSAGGPRSTELSDGPGLGTDSSALSPTGDSATEGPDPFESSS
DEVDLTSSPTHPTDRCAADPPTGDPRSADSPVTAAPGDGGAAAAPGSIGPPSKCPGSSQA
RPLSSQASTDQPDPGVAPGEATGWPDPVVASPTPALFVQLHGGVVRRLGDDERPLQIFNE
YLTDLGFEDPWRVQGEGMNPEVGCLIRFYFDGKRIPFTPHSTNHALYGERHRMMFLHVNN
ARKQMLRLRLNIWRKRQVTLSETCLIVSSVKHAHTGKMHILPLIREKVEEVRRHSHCLAF
SSAGPQSQTYYVSYASYTEHLRWQRTASKIASQRVNSVDLSGCSLEELPAQLFYSQDLTH
LNLKNNFLSLHKGVPALTRFCKLRSLSLSNNTLPDFPSALCDITSLTELNLSGNRLSSLP
AEVGAMHNLQTLLLDGNSLGSLPVELGSLEGLTYLGLSFNRFSCVPPVLEKLPGLERLCL
AGNQLSVLDMAGLQWLPARHIDLRLNRLQKVTPGDAEQLVHIVQLDLRDTGLQELDVTAL
RRLELLRCDRNTLSRLRVNGLALKSLHAAHNELKLLEVEPVPENLSVLDLSWNTLGCVPP
WVCESSGLEVLDINHNYVTELPAQLLCNGSLRKLLAGWNQVCRLAERLERSQLEVLDLQH
NHLTELPHNLFIKAQSLKYLNVSANKLESLPAASLSEDSFSSLEELFATNNRLADKCVPL
LTGHSHLRVLHLAYNQLQTFTASKLARLEQLEELDLSGNRLRAVPTTILSCQRLHTLSAH
SNCINAFPEVLQLPEIKFVDLSCNELTEVTLPETLPQKLQELDLKGNPRLTLDHKSLELL
NNIKCFRVDPSPSALCVSESHGAPSVWSHGYTEASGVKNKLCVAALALDGFCGIREALYG
VFDGDKNVEVPYLLQCTMGDVLAEELHGGQRQGDYMTNTFLTMQRKLGTAGQRMGGSAAL
CHIRHDPMAPGEHGGCFTLKAANVGRCQAVLCRDGRAVPLSTTHSVKEGPEYQRVRQHNA
IVTEDNKVSGITDSTRIMGYSFLCPSVTPRPHVSTVTLTPQDEFFLLGSRGLWDTVSPGE
AVEAVRNVPDALAAAKKLVTLAQSYGCSDSLSAVVVQLSITEDCCCFCEPPPPPPSPGPA
SHTSAHAYSASGDGGVPLPPASSSGTASEASSEFSTSEMSSEVGSTASSEEPAPHADPPA
GHPSLPGRGGAQRLACGGGSGFRRQFSGALSDNGVDSEDEEPIAGVFSNGSRVEVEADVH
CLRRLGRAAHQTHAQPSTCSPAAAASHRGEAQSGTLGRRARANGSVACQGRSQDIIEEAA
DAPVRKQGGYFNAPAQPDPDDQLIIPPELEEEVRQIIQQQQQIQAHNQPAHSFQKPADYF
VTPL
Download sequence
Identical sequences G3NLY2
ENSGACP00000006345 69293.ENSGACP00000006345 ENSGACP00000006345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]