SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006371 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006371
Domain Number 1 Region: 455-651,752-1010
Classification Level Classification E-value
Superfamily Ras GEF 7.06e-101
Family Ras GEF 0.0003
Further Details:      
 
Domain Number 2 Region: 198-336
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-42
Family DEP domain 0.000000601
Further Details:      
 
Domain Number 3 Region: 659-760
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-35
Family Ras-binding domain, RBD 0.0011
Further Details:      
 
Domain Number 4 Region: 18-156
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.01e-27
Family cAMP-binding domain 0.000000733
Further Details:      
 
Domain Number 5 Region: 329-458
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-25
Family cAMP-binding domain 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006371   Gene: ENSGACG00000004808   Transcript: ENSGACT00000006388
Sequence length 1011
Comment pep:known_by_projection group:BROADS1:groupXVI:10104986:10129378:-1 gene:ENSGACG00000004808 transcript:ENSGACT00000006388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAARTSSHSSESVEWIICLDKRPAERSGEDVDIILARLKNVKAFERFPPILLQQICLCG
FYECLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETSSYQDAVTICTLGAGTAFGESILD
NTPRHATIVTREFSELLRIEQREFRSLWEKYHQCMAGLLAPPYGVMESGCSGDTMPDKEN
ISNNSFVSVSKHQNKVPSEKILRAGRILRNAILSGAPHMIRDRKYHLKTYRRCCVGTELV
DWQIQQSSCIHSRVQAVGLWQVLLEEGVLNHVDQELSFQDKYLFYRFLDDEQEDAPLPGE
AEGKESQEELQDTLLLLSQIGPDAHMRMILRKHPSERTADDLEIIYEELLHIKALSHLST
TVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFG
KLALVNDAPRAASIVLREDNCHFLTVDKEDFNRILRDVEANTVRLKEHGQDVLVLEKSLG
SSRASTHGASSSHYKYKVISGTPEKILEHLLEMMRLDSQFTESADSALDDFVLTHCVFIP
NGQLCPVLMAHYHAEALQGSEQEKRDYTLNNKRRVIRLVMQWAAVHRDHLQEEDTSVAFL
EEFVTAVSNDVKALPALGDQLTELERSLKRNTDDARVSKKKHKVLLRQFSMGDEKLQKRQ
PIKSNDEILLKVYCCDHTYTTIRVPVGASVREVVGAVADKLGSAEDLLLVGLSSAGEKVI
FKPNDVSVFSTLSINARLFACRRDQLDSLTPLPEQEGSSTGPLASFELMSSKDVAYHMTS
YDWELFHCVHELELLYHTFGRQNLKKTTVNLDLFLRRFNEIQFWVITEMCLCSQLSKRVQ
LLKKFIKIAAQSCKEYRNLNAFFAVIMGLSNPAVCRLSQTWEKLPSKFKRFYGEFENLMD
PSRNHRAYRLTVAKLEPPIIPFMPLLIKADMTFTHEGNRTFIDYLVNFEKMRMIANTLKI
VRYCRSQAFSPDSTQASKNQAEVRTYVRQFKVIDNQRTLSQLSHRLEPRRS
Download sequence
Identical sequences G3NM08
69293.ENSGACP00000006371 ENSGACP00000006371 ENSGACP00000006371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]