SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006379 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006379
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.85e-16
Family THAP domain 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006379
Domain Number - Region: 83-101
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0264
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006379   Gene: ENSGACG00000004832   Transcript: ENSGACT00000006396
Sequence length 225
Comment pep:novel group:BROADS1:groupV:5787278:5790534:-1 gene:ENSGACG00000004832 transcript:ENSGACT00000006396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYHCVAFGCGKTAEDGVKLFKFPKDPEEFRKWEKQVQRTRSQWVATSSSHLCSEHFGKE
YFEPKQLPGALVLKLGAVPTVFVRPHCSSCNGVGCSKCLPAIQRRGITAEPKERAASAEY
NETASAQFDETDGGGDKDLTGHLTGEGVMWGGGNKEVPVVCEMCGTTGSMSAFFSKTKRF
CSISCSRSYSSNSKKTSILARLQGRPPSKKVLNKMNKSPPAAAAL
Download sequence
Identical sequences G3NM16
ENSGACP00000006379 ENSGACP00000006379 69293.ENSGACP00000006379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]