SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006400 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006400
Domain Number 1 Region: 333-461,758-932
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.36e-51
Family Diacylglycerol kinase-like 0.017
Further Details:      
 
Domain Number 2 Region: 1145-1211
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-17
Family SAM (sterile alpha motif) domain 0.003
Further Details:      
 
Domain Number 3 Region: 63-144
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000603
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 4 Region: 255-303
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00087
Further Details:      
 
Domain Number 5 Region: 194-230
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000106
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006400   Gene: ENSGACG00000004826   Transcript: ENSGACT00000006417
Sequence length 1218
Comment pep:known_by_projection group:BROADS1:groupI:518206:536065:-1 gene:ENSGACG00000004826 transcript:ENSGACT00000006417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSASGGRSLSSSSRGSEHRMADLTESAPARFPDESSDSEPEQEPGTPQKLIRKVSTSGQI
RSKTVLREGNLMKQTNSFQRWKRRYFKLRGRTLYYAQTSKSIIFDEVDLTDASVAESSTK
NVNNSFTTGMSSLKLYHRSADSQKKTTEPFIRNTSDVHVMKPLEKKQNHVGFCFLQANPN
LSVGTQALLCSSWTGSLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIE
DEDGVSVMPISGWRGTWPVSAKCNVCDKNGSVLRLQDWRCLWCKAMVHSGCKEQLSSKCP
LGQCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLN
PAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDALTLHKQCQLGVLPLG
TGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWRIMVYETKFPRQHSGSTVTED
CSDDSEILTYEDSVAAHLSKILTSDQHSVVISSARVLCETVKDLVARVGKASEKNTESSD
ESELMAKKVLKEKLDSLLKTLNEESQACMLPPPAPPPTIAEEQEDADSVERPPSLHHHRH
HPPPHVPPCSPRGSASSSTAAIFKPREQLMLRANSLKKAIRQIMEHTERAVDEQNLQTQQ
QLFTSSRPEEDEGFGASLQSSSSRKHHSACKVGKTPCEKLISKGGDGEMPTLNTKILYSG
LRGISVSLSSSSVISQLLVNADPFSCDPDNVYRDCYTEKCVMNNYFGIGLDAKISLDFNN
KRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLEECDGRPIPLPSLQGIAVL
NIPSYAGGTNFWGGTKEDDMFTAPSFDDKILEVVAVFGSMQMAVSRVINLQHHRITQCRT
VKIKILGDEGVPVQVDGEAWVQPPGYIKIIHKNRTQTLTRDLVYANVLFYLKPTAQQGVQ
WVCMYLYVHVKKKTAIYMLLYSIQFIYKCASDTPTKCFSIREVAETHHSLEQELAHAVNA
SSKAMDVVYANSNNSQALCCSVVLQMVSNVKALLSETELLLAGKMSMQLDPPQQEQLKAA
LSSVAQQLRRLADVSWLSVIEPSDYEVQGPDFSKRSRSTKFRLVPKFKKDKNNKNKETCT
TLSLPVHQWGTEEVGAWLGFLSLNEYQDIFMGHDVRGAELIHLERRDLKDLGVTKVGHIK
RILHGIRELNRNSSASEA
Download sequence
Identical sequences G3NM37
69293.ENSGACP00000006400 ENSGACP00000006400 ENSGACP00000006400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]