SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006417 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006417
Domain Number 1 Region: 298-426,715-889
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.27e-51
Family Diacylglycerol kinase-like 0.017
Further Details:      
 
Domain Number 2 Region: 1094-1160
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.43e-17
Family SAM (sterile alpha motif) domain 0.003
Further Details:      
 
Domain Number 3 Region: 32-95
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000493
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 220-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000179
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00087
Further Details:      
 
Domain Number 5 Region: 142-196
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000942
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006417   Gene: ENSGACG00000004826   Transcript: ENSGACT00000006434
Sequence length 1167
Comment pep:known_by_projection group:BROADS1:groupI:518977:535972:-1 gene:ENSGACG00000004826 transcript:ENSGACT00000006434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDESSDSEPEQEPGTPQKLIRKVSTSGQIRSKTVLREGNLMKQTNSFQRWKRRYFKLRGR
TLYYAQTSKSIIFDEVDLTDASVAESSTKNVNNSFTSISVCVCGGVRGRRDDQQEVALSH
RRGSRRAHCRETQTGMSSLKLYHSLFLSVWEHRLYCVAAGQEVDGVTSHGLSCEVCKFKA
HKRCAVRATNNCKWTTLASIGKDIIEDEDGGVMPISGWRGTWPVSAKCNVCDKNGSVLRL
QDWRCLWCKAMVHSGCKEQLSSKCPLGQCKVSVIPPTALNSIDSDGFWKASCPPSCTSPL
LVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGS
VGWVLSEIDALTLHKQCQLGVLPLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKM
LDRWRIMVYETKFPRQHSGSTVTEDCSDDSEIEVQQILTYEDSVAAHLSKILTSDQHSVV
ISSARVLCETVKDLVARVGKASEKNTESSDESELMAKKVLKEKLDSLLKTLNEESQACML
PPPAPPPTIAEEQEDADSVVPPCSPRGSASSSTAAIFKPREQLMLRANSLKKAIRQIMEH
TERAVDEQNLQTQQQLFTSSRPEEDEKAPQRMQRYGTGSAVSGPAGNRWIVGKTPCEKLI
SKGGDGEMPTLNTKILYSGLRGISVSLSSSSVISQLLVNADPFSCDPDNVDCYTEKCVMN
NYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLEE
CDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDMFTAPSFDDKILEVVAVFGSMQMA
VSRVINLQHHRITQCRTVKIKILGDEGVPVQVDGEAWVQPPGYIKIIHKNRTQTLTRDNI
TSYVGTLSCCWSFYYKMKVYVPQTDICIQFNSFINVPQTHPQNVLCFSIREVAETHHSLE
QELAHAVNASSKAMDVVYANSNNSQALCCSVVLQMVSNVKALLSETELLLAGKMSMQLDP
PQQEQLKAALSSVAQQLRRLADVSWLSPIEPSDYEVQGPDFSKRSRSTKFRLVPKFKKDK
NNKNKETCTTLSLPVHQWGTEEVGAWLGFLSLNEYQDIFMGHDVRGAELIHLERRDLKDL
GVTKVGHIKRILHGIRELNRNSSASEA
Download sequence
Identical sequences G3NM54
ENSGACP00000006417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]