SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006451 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006451
Domain Number 1 Region: 5-284
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.72e-64
Family BAR domain 0.00061
Further Details:      
 
Domain Number 2 Region: 403-513
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.45e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00024
Further Details:      
 
Domain Number 3 Region: 599-723
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-25
Family Ankyrin repeat 0.0007
Further Details:      
 
Domain Number 4 Region: 261-357
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006451   Gene: ENSGACG00000004876   Transcript: ENSGACT00000006468
Sequence length 769
Comment pep:known_by_projection group:BROADS1:groupI:559077:566856:-1 gene:ENSGACG00000004876 transcript:ENSGACT00000006468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLLDFEECVRDSPHFRLKLELFEADVSVLETQLEKVMKLCGKMVEAGQAYNAANQLFL
TGLAELSAHNKTDDVITNCLSQFNQGLQEVVSFHSMLFDQTQRAIGQQLTNLCTQFLPQL
VETRREFVRIGEDLETAAVKSAQVSRKAGEAERASHLLLATRKCYQHFALDYCLFQLNTF
KAQQRVDILNSMFSFVHAQFTFFHQGFDLLRDLEPAMKTMAAQLSQLSAECAAQRKQLEN
KHLLVQQRDASGEQTVSPCPNSDAIISGFLFKRSRRKPKTWKRYTGFSIRDNQLLYRKSP
REEPLVLFEDLRLCAVKSTEHTERRFCLELLSIKKCCALQADSDLVKRSWLGALQGSIDF
AYGDAGSQAPCSFTCRLLHPREAPPLSPGPSPAQRPAALAVALGGPGNQRCCDCGEEEPR
WASINLGVTMCIQCSGIHRSLGVHLSKVRSLTLDSWEAEQLKLLCILGNDVMNQIYEARC
SEEGRVKPGADSPRAEKETWIKEKYVHKRFLHSSISLSGLDTTCLRRTSLRPLHRRETDG
RRGRGRVRLARRLNRCIVSLLSNLTGKTGGDEDVGDKPGGQTHESKTDKNSSGGEAGLRL
YRAAAAGDLVAMAMALAQGAPVNGSIDEEAGRTPLIGAAVGGSMSACEFLLLNGANVNHR
DLRGQGALHAAATAGHTGLVCLLLKKGANQYAADERGQDPLAIAVETAHADIVTLLRMAR
MNEEMRDSDGFFGASGDDETFQDIFRDFSDMASHDPERLSRRRFRSISF
Download sequence
Identical sequences G3NM88
ENSGACP00000006451 ENSGACP00000006451 69293.ENSGACP00000006451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]