SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006460 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006460
Domain Number 1 Region: 275-434
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-41
Family Phosphotyrosine-binding domain (PTB) 0.0031
Further Details:      
 
Domain Number 2 Region: 135-192
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000275
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 97-126
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000353
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006460   Gene: ENSGACG00000004889   Transcript: ENSGACT00000006477
Sequence length 472
Comment pep:known_by_projection group:BROADS1:groupXVII:2937153:2960866:-1 gene:ENSGACG00000004889 transcript:ENSGACT00000006477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGRSGSVSNCSSGQPSAERMPSFASEWDEIEKIMNLIGAGIETSEEQRPTRSSDTWSST
LASALPGPSHSIGTLAYESKEELEGFGRMRKLGSNVMEDQDLRDFGITDPGHRKKILHAA
RSLPKVKALGCDGSTSLVTWLDGLGLHEYLPNFLSSGYRTLECVKNLWELEIVNVIKIGA
LGHRKRIIASLAERPYEEAPSKSRRMSPIMFHDLLSQTTSPLSQMDPYTSRSMDMLLPSS
ESDRRRRGVDQDCSVSLRSYSERPRSVDRKSERHKDSRLNLRPPSTSATYATVSAWHHQP
EKLILDSCGYEATYLGSMVIRDLRGIESTQEACAKIRKKSKDARKGPVVILSITYRGVKF
IDAATKAIVAEHEIRNISCAAQDPDDLCAFAYITKDLNSGHHFCHVFSTVEVTQTYEIIL
TLGQAFEVAYQMAMQARARHYVPPTSLSPEVIETKASRPVSQSWSSMRRSAV
Download sequence
Identical sequences G3NM97
ENSGACP00000006460 69293.ENSGACP00000006460 ENSGACP00000006460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]