SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006479 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006479
Domain Number 1 Region: 22-64
Classification Level Classification E-value
Superfamily UBA-like 0.0000112
Family TAP-C domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006479   Gene: ENSGACG00000004904   Transcript: ENSGACT00000006496
Sequence length 285
Comment pep:known_by_projection group:BROADS1:groupXVII:2973993:2977882:1 gene:ENSGACG00000004904 transcript:ENSGACT00000006496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTDMDVDAELMQKFSCMGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNVNTPSMSFVEDVTIGEGESVPPDTPFTKTWRIQNTGAESWPPGVCLKYIGG
DQFGHVNTVMVKSLDPQEISDVSVQMRSPTAPGMYQGQWRMCTASGLFYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPQRNVQEDFNPFASPQKNKHDATDDSFRDPGGAWERTQE
PIQQDENGLSLSHNAVNRASNGLQTNLSVVTYGQGIHGPYPFGQS
Download sequence
Identical sequences G3NMB6
ENSGACP00000006479 69293.ENSGACP00000006479 ENSGACP00000006479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]