SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006485 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006485
Domain Number 1 Region: 137-223
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.43e-18
Family Ubiquitin-related 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006485   Gene: ENSGACG00000004908   Transcript: ENSGACT00000006502
Sequence length 261
Comment pep:known_by_projection group:BROADS1:groupV:5970111:5974485:-1 gene:ENSGACG00000004908 transcript:ENSGACT00000006502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCVGRYWEGWEDSQSRGSSRNGGRGARNEPLKKERPKWKSDYPMTEGQLRSKRDEFWD
TAPAFEGRKEIWDALKAAAVALEGSDHDLAQAIVDGANITLPHGNLAECYDELGTRYQLP
VYCLAPPINLISERCDDDPSDSAEPPVAPKKEFQLKVRLSTGTDLRLSASMADTIGLLKK
QLQAQEDIDTSHQRWFFSGKLLPDKTRLQDTKIQKDFVIQVIVNPQALQGPKTPPSPTTT
TTTEVGAANPSPTSTSSPESE
Download sequence
Identical sequences G3NMC2
ENSGACP00000006485 69293.ENSGACP00000006485 ENSGACP00000006485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]