SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006676 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006676
Domain Number 1 Region: 56-293
Classification Level Classification E-value
Superfamily L domain-like 1.5e-25
Family Internalin LRR domain 0.01
Further Details:      
 
Domain Number 2 Region: 344-428
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000233
Family Ubiquitin-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006676   Gene: ENSGACG00000005051   Transcript: ENSGACT00000006693
Sequence length 429
Comment pep:known_by_projection group:BROADS1:groupI:845685:849887:-1 gene:ENSGACG00000005051 transcript:ENSGACT00000006693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPEDAGGRSFVEVLSEKYSPENFPLRRGPGMGVVVVPTAAPQGSAMKDRLNMPTILVL
NSCGIRRAGDQTEIAAFCAHVIELDLSHNQLQDWREISKIVSNIPNLEFLNLSSNPLSGR
SLEPRCAGGFSRVRRLVLNNTRVSWDTVMLLTSEIPELEELFLCLNEYGAVGASGVACPT
LRLLHITHNGLQDWAEVRKLGPMFPGLDTLVMSNNNLSSIQDGEDVLRRLFPNLRSISLT
NSGLSRWEDIEKLNWFPKLEEVRLQGIPLLQSYTNAERRSLMIAHLPVISLLNSSVVSDC
EREDAERFFIRYYVDHPEEEQPNRYHSLVTKYGKLEPLAEIDLRPRNRALVEVRCEDKVE
ELSIRLDQTVAELKKQLTTVVQLSTSSMRIYYIDKGSAFGPEEMKYNTRAVHSYSIQDGD
EILVVPKTK
Download sequence
Identical sequences G3NMW3
ENSGACP00000006676 ENSGACP00000006676 69293.ENSGACP00000006676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]