SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006710 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000006710
Domain Number - Region: 63-192
Classification Level Classification E-value
Superfamily PH domain-like 0.00223
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006710   Gene: ENSGACG00000005076   Transcript: ENSGACT00000006727
Sequence length 610
Comment pep:known_by_projection group:BROADS1:groupVIII:3820035:3829797:1 gene:ENSGACG00000005076 transcript:ENSGACT00000006727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPASLRLTDHKRDNVKGRAEAELREFSPYYRKQFSLARFSKVEDDLEQHKEKITQLLKQR
GAPEGGEVLYEDPVLYFDDTRKWRERYVVVRANYCLECHDGLESFVKGIPPRQNLLPTGG
TVLTTEEKYMVMVDKCFPDDTSAKEDFAPPLSGMPGQFPVYLRLPYRRDYYFCFRNEAKK
EAFLSILSDCIRHQNHDFLKKKTCEVQAFLKAIQLYRQDKGQYEPWDMLIGSDVRVMANL
VMEQLLPILQKDLLPRLKSKKAERKRVWFATVEAAYIVVQERLLEGLAALKEECQTSVRQ
QEVLIHSDMDQILNTRRQLEEKVRDRVSARAEKLFSESVQPYLASVLEELMEPVSCGFLE
GRQLSEHAMDQVCQDVLRLADKEELRKALADMARPNLLSCYQKIASLQERLQDLQKRFGL
SSISRVIYSAQIDLQQLIENAAYTFELLLHKAVQDNPNNPGPAIEKAKPRVLKQYDYDSS
TVRKRISREALVYITLPFIKKTLSSCRTQELQGLEQSVYAEHSNFIHIENIYESILLESL
DKEVTKVVKEAASLKKYNLFTDSRDLLSQSSRSSLSSPPVSTPGTPAMELASLLKTSVEP
QPPSPLVLNG
Download sequence
Identical sequences G3NMZ7
69293.ENSGACP00000006710 ENSGACP00000006710 ENSGACP00000006710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]