SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006814 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006814
Domain Number 1 Region: 92-166
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000011
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006814   Gene: ENSGACG00000005147   Transcript: ENSGACT00000006831
Sequence length 293
Comment pep:known_by_projection group:BROADS1:groupX:7791656:7795427:-1 gene:ENSGACG00000005147 transcript:ENSGACT00000006831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSLSPVSVAEKKVPPKFLPVSATPQPKERRSPQRRHSIEKESPTSVRPFAPPSRQSAK
SLMMADPRAKVDAASGAQGPEEFRYPVECLALTVEEVMHIRQVLVKAELEKFQQYKEIYI
SLKKGKVCFSCRTKRFSLFTWSYTCQFCKRPVCSPCSRKMRLPSKPYSTLPIYALGPSAM
AKEEAGGASGPAVPEKNPFGSAHSRSSLRRSVHNKDGQSQDEPELPKELTEDWVTMEICV
DCKKFITEIITSSKRSLCVATKRARLNRKTQSFYMSSSNSVNFRPSERSIKEV
Download sequence
Identical sequences G3NNA0
ENSGACP00000006814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]