SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006825 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006825
Domain Number 1 Region: 384-398,435-641
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 4.84e-35
Family Cofactor-dependent phosphoglycerate mutase 0.019
Further Details:      
 
Domain Number 2 Region: 30-88
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000606
Family UBA domain 0.00071
Further Details:      
 
Domain Number 3 Region: 259-322
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000347
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 4 Region: 94-224
Classification Level Classification E-value
Superfamily LigT-like 0.0000101
Family Atu0111-like 0.064
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006825
Domain Number - Region: 404-431
Classification Level Classification E-value
Superfamily Cyanovirin-N 0.0916
Family Cyanovirin-N 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006825   Gene: ENSGACG00000005161   Transcript: ENSGACT00000006842
Sequence length 648
Comment pep:known_by_projection group:BROADS1:groupI:913769:925638:1 gene:ENSGACG00000005161 transcript:ENSGACT00000006842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEADGGGTGLSTMAAKEDLHSRIVPRRLRQNRAGSEASGSDLDVLLSMGFPRPRALKALV
STGGRSVQAACDWLFSHLDDPFLDDPLPREFVLYLRPSGPLQNQLSHFWQQSRVTCGKNK
AHNIFPHITLCQFFMCADPQVEALCEALKASVQQWRGRFPSPLPLDLYTSSNFIGLFVEK
QAADVLKLFAADFATEASRMAEVHVEPHRKQLHVTLAYNFPANHLPPLKKLAKGIEVKLG
CDWLAVLFSRDIRFANHDTLRAVYPYAPQNEDELELAPGDFVFASPLDQGGTSEGWVHGT
SLASGLSGLLPENYVGLADESDAWVFHGSHSFFSQGPGDRGAFDGLPDGRRSDRPGDTPT
PSVTCHPMQQVLRIGAGSSRQPKRTLFVCRHGERMDVVFGKHWLSLCSDSKGRYVRSNLN
MPPCLPLWGGQRDYHMDAPITVFGSTQAQLVGEALLESNAAIDLVYCSPSLRCVQTAQNI
LKGLQQEGKLRVRVEPGLFEWTKWVSGSSLPSWIPPADLAAAHFSVDATYRPLVAVDSLS
ASESYESYMRRSHQVTRDILSDSRNAAGNHVLIVAHASSLEACTRQLQGRGPQSAKDFIQ
VVRKIPYLGFCCCEEQADTGVWQLVDPPILPLTHGPNHSFDWRETLQQ
Download sequence
Identical sequences G3NNB1
ENSGACP00000006825 69293.ENSGACP00000006825 ENSGACP00000006825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]