SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006838 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006838
Domain Number 1 Region: 199-325
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-42
Family Third domain of FERM 0.000000831
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.24e-35
Family Second domain of FERM 0.00000316
Further Details:      
 
Domain Number 3 Region: 496-584
Classification Level Classification E-value
Superfamily Moesin tail domain 5.36e-31
Family Moesin tail domain 0.0000356
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-23
Family First domain of FERM 0.0000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006838   Gene: ENSGACG00000005170   Transcript: ENSGACT00000006855
Sequence length 584
Comment pep:known_by_projection group:BROADS1:groupXV:1466149:1473292:-1 gene:ENSGACG00000005170 transcript:ENSGACT00000006855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTVNVRVTSMDAELEFSFQPNTTGKQLFDQVARTIGLREIWYFGLQFVDSKGFITWLN
SEKKVMVQDVRKETPLQFKLKAKFYPEDVAEELIQDVTRRLFFLQVKEDILGEEIYCPPE
TAVLLGSYAVQAKYGEQEKSALEPGYLSSERLLPKRVLEQHKLSKEQWEERIQVWHEEHR
SMLKEEAMIEYLKIAQDLEMYGVNYFEIKNKKGSDLWLGVDALGVNIYEKNDKLSPKIGF
PWSEIRNISFNDKKFIIKPIDKKAPDFIFYAPRLRVNKRILQLCMGNHELFMRRRKADTI
EVQQMKAQAKEERLQKKMERSKESHPPRGRVVNVFGSRGSPQGSAGRRELMMKLSQFEET
TKRAERELQEQLDRAMRLEEERRRVEQEAARLEAERMEAIIAKEELARQAEDQIRSQEQL
TLELADYSAKITLLEEIKREKEEEAESWHIKAKEVEENLIKTKEELHSVRSSSNLIPVKD
NEDNEGSDHESEENNTYSAELQTQEVNNHHEEEERLTEAEKNQRLQEQLMALSSELSEAR
HDDKKTANDVLHAENVRVGRDKYKTLRQIRMGNTKQRVDEFEAL
Download sequence
Identical sequences G3NNC4
ENSGACP00000006838 ENSGACP00000006838 69293.ENSGACP00000006838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]