SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006880 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000006880
Domain Number - Region: 23-82
Classification Level Classification E-value
Superfamily PH domain-like 0.0105
Family GRAM domain 0.057
Further Details:      
 
Domain Number - Region: 152-219
Classification Level Classification E-value
Superfamily PH domain-like 0.0114
Family TFIIH domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006880   Gene: ENSGACG00000005191   Transcript: ENSGACT00000006897
Sequence length 342
Comment pep:known_by_projection group:BROADS1:groupXVI:10445556:10449327:-1 gene:ENSGACG00000005191 transcript:ENSGACT00000006897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVLDALWEDRDVRFDITAQQMKTRPGEALIDCLDSIEDTKGNNGDRGRLLVTNLRIIW
HSLALPRVNLSVGYNSIINITTRTAYSKLRGQTEALYILTKSNNTRFEFIFTNVVPGSPR
LFTSVIAVHRAYETSKMYRDLKLRAALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGT
FFITNVRIVWHANMNESFNVSIPYLQIWSIRIRDSKFGLALVIESSRQSGGYVLGFKIDP
VDKLQDALKEINSLHKVYSANPIFGVEYEMEEKPQPLEELTVEQAPDDVEIEPDEQTDAF
TAYFADGNKQQDREPVFSEDLGLAVEKLKEGFTLQGLWEVIG
Download sequence
Identical sequences G3NNG6
69293.ENSGACP00000006880 ENSGACP00000006880 ENSGACP00000006880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]