SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006908 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006908
Domain Number 1 Region: 1242-1355
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-22
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 2 Region: 39-134
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.98e-21
Family FHA domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006908
Domain Number - Region: 712-743,1244-1264
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0345
Family BAR domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006908   Gene: ENSGACG00000005214   Transcript: ENSGACT00000006925
Sequence length 1366
Comment pep:known_by_projection group:BROADS1:groupI:959004:989717:1 gene:ENSGACG00000005214 transcript:ENSGACT00000006925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLNRNMPECGLQTHQVLKSTALDLIESGKGLKFQAERPHLVSLGSGRLSTAITLLPLP
EGRTTLGHGNMDISIQGPGVEAQHCYIDNRSKVITLHPCGNLCSVDGLQVSQPVRLSQGC
MLCFGQSAFFRFNHPEEACRMKSMLPHGGGVSTGDYRLRPGTKPPCIPPKHGNKSPLTLP
AGARAQSEHSAIVSSIERDLQDIMDSLAMDDPQPSKPPPRSSLLSPVLNGGGRYLLSPPA
SPGAMSVGSSYENASPPFSPLSSPSGASSGGFTSPSPGGPQEQSLSQPPVPLRSSSYNFT
AQPPPMPHPRSALKVQESPRLQRRVMKEAPQSPKPGRRGLGQEGPESPRLLSSSESLSGR
TAALSSPRPAIKFPACPSPPGHRTKTATVLQERPASPFRDWTGPADCPPGQLSHPSRAFQ
GSPLQQQQPPRLLQPPESPRTPRKNTELNGGGMRELPPLSPSMARRGVPGALPTLRTPDS
PSSLGKFLIPESPRLRRRAGSASEEPAGGRGVLARSPSPTMEVGGGGGARKASLGNSLSP
AYSLGSLPGSSPAASPRSRRKASGGRPHPPMRERKNSISEISDNEDELLEYHRRQREERL
REQEMERLERQRLETILHLCAEYNKGETSCDPLPSGSTGFPGGPSNDNAIGGPASSAAGG
LHLLQRQRESDEENLKEECSSTESTHQEHEDSSGLELSYLEEERVRVLARIDELKSRLTE
LEQQLQEAKQEAEMERALLQGERQAELDQIEAETDIITQLQRKLDELESAIQREKEKDGD
ALETGTKKFEDLEFQQLERESSLEEERETISQQLLQERAEYHGSVSRRKEKVSALENQAG
QLGLQATQEYERLAGDRGLALQMLHKEKERLSALEKRYHGLTGGRSFPKSSTAMREYPSE
GSRPPLPKLDLEQWYQELMSGSGPLGPPSLPATALSGRRPALQGDGFTLLPPPPRGSAPS
WKESRPPPSTGACLEKGPHHLTQSPLLATNSTGSLPRNLATTQDIEAKRQIALQQKAGHQ
VIEEQRRRLAELKQRAAVEAQCQWEALRGSQSQLVASSTSPPSYSPGAAYGFGPPPLVHH
SILHHQPPAAGEQPYDTLSLESSDSMDTSVSTGNNSACSPDYMSSVGGADAAKIEEMEKM
LREAQMEKARLIESRERETVARRHMLEEERRRREDAEKRLQEETFHRQQLVDKEVKMRAK
NFSQARPMTRYLPIRKEEFDLRSHVESSGHSVETCYHVLLNEKVCRGYLVKMGGKIKSWK
KRWFVFDRLKRTFSYYVDKHESKLKGVIYFQAIEEVYYDHLRSATKVHFLRSVLFAAVTE
SPNPSLTFCVKTHDRLYYMVAPAADAMRIWMDVIVTGAEGYTQFMN
Download sequence
Identical sequences G3NNJ4
ENSGACP00000006908 ENSGACP00000006908 69293.ENSGACP00000006908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]