SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006910 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006910
Domain Number 1 Region: 78-298
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-55
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 440-500
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000236
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 299-421
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000636
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006910   Gene: ENSGACG00000005221   Transcript: ENSGACT00000006927
Sequence length 524
Comment pep:known_by_projection group:BROADS1:groupXII:5736319:5739319:-1 gene:ENSGACG00000005221 transcript:ENSGACT00000006927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGSNRLSRFLPSSAILYQEYSDVAINREIQRQQGKEPGPEEEGLRDEGSDGAPSPSNLS
PSSSFRSSRGSAFALWQDIPDVRTSGQLDNFSNDERKLQEAKFELVTSEASYIRSLTIAV
DHFMLSQELAECLGAQDKQWLFSKLPEVKGVSERFLQDLEHRLEEDILRFDVCDIVLEHC
PALRRVYLPYVTNQAYQEQTYQRLLQENPRFPGILARLEEDPICQRLPLTSFLILPFQRI
TRLKMLVENILKRTTPGSRDEDTATKAFNQLKKIIKECNSSVQSMKRMEELIHLNKKINF
EGKIFPLISQSRWLVKHGELLEVDTQTMSISGSKLKLPTRPVYLHLFNDCLLLSRRKDAW
KFMVFVHAKIGELKVKDLSQKLQGISGFIFHLQLCGGQQLKHQILLKSHTESGKQRWITA
MFPSDPLEDIEQANENDDISQVQCIKSYQALEHDELTLEKADILHAKTITSDGWVEGIRL
SDGERGWFPKTYVEEITSRSARLRNLRENIRIKCVTQKLEGGRL
Download sequence
Identical sequences G3NNJ6
69293.ENSGACP00000006910 ENSGACP00000006910 ENSGACP00000006910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]