SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007072 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007072
Domain Number 1 Region: 1126-1322
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000248
Further Details:      
 
Domain Number 2 Region: 906-1033
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-27
Family Pleckstrin-homology domain (PH domain) 0.0000111
Further Details:      
 
Domain Number 3 Region: 45-168
Classification Level Classification E-value
Superfamily PDZ domain-like 6.23e-18
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007072   Gene: ENSGACG00000005346   Transcript: ENSGACT00000007090
Sequence length 1892
Comment pep:known_by_projection group:BROADS1:groupXXI:11154594:11179411:1 gene:ENSGACG00000005346 transcript:ENSGACT00000007090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGDRSVIVQTRQTAPRKPRCAIMAKQKDGRDQSEASAVASLGPDEEPFSWPGPKTLRLRR
TSQGFGFTLRHFIVYPPESAVHNSLKDEDNGSRVIKPGRQRNRLEPMDTIFVKQVKEGGP
AHGAGLCTGDRIVKVNGESIIGKTYSQVIALIQNSDASLELCVMPKDEDILQLAYSQDAY
LKGNDAYSGNAQNIPEPPPICYPRIEVKSAAMAQTSEPAAVTESPPGPAQGPARRGGAAE
KSPAAPPQGSKSQTAVCVCSESVRTAAMPPDPVDRGSRVARAGPSHRTEENRHSHSAESS
AAPRPLVPSAPGGAQVRYPSSRPADSPACSPPARPGAPCPDLLSPAVRATAASPDTFSSA
ASPGGNHYSPSPTTPSTSPHQNIDWKNYTTYKDYIDTKRLHTYGCRTIQERLDSLRAAAN
STSAYAQQRTPPAPSTPPRGAPGSQVRWRSTSIERGVDPSSEGAAGTSLRSVSQERLGGG
GGRAPPGVPWPRSASEDALPFSSPAGVPEPRARSCDYLGQRPGEPAGSAAFGDRAVLEDR
MMLCRGEEARASRQGAGPRAMPHLNRSLTGREGGLSNSAPVFTKFTTDIAPTPRTDGVVM
RPSRLSVKNAISEPPPALSSARAIDPPKDQRANIVGNHLCYSSPLHLQHRGRADSLKMKQ
LQSVVAAASSSGSSTSNVAVTQTPRAREMSSSTGALPRINGGLSEGVEGPDAIVVVLRRD
KNSGPPHIRPPSYVLALNDNQAGSADGAMCRTSSDGFKETHLRRLGDARLKSGSNDLDGS
LDSIPFIDEPSSPSTDQDSTHVPACAIICGTPVIATIPPSPSSLSPLIRRHLSHDQDSLR
LTVAESDSGTKTERSKSYDEGLDNYRGEGIGSLIPGLKSLRKAGDRSSEDSGSRRDSSSD
VFCDATKEGLLHFKQLNTEKSKRVGGGMRPWKQMYAVLRGRYLCLYKDKKEGQAHANCQA
VDEPLPISIKACLIDISYSDTKRKNVLRLTTSDCEYLFQAEDREDMLAWIRVIQENGNMD
EENSVFTSHDLISRKIKEYNTLMSPTGGKTEASPKPSRQSLSIRHTLLGGKGDNKATSPP
TAKTEQERKNVHKDDTSPPKDKGTWRKSIPGLMRKPFERKPSPGVTFGVRLDDCPPAQTN
KFVPLIVEVCCKLVEERGLEYTGIYRVPGNNAAISNMQEELNNKGMSDIDVQDDKWRDLN
VISSLLKSFFRKLPEPLFTNDRYADFIDANRTEDPVERLKVLKRLLHELPDHHYETLKFL
SAHLKTVADNSEKNKMEPRNLAIVFGPTLVRTTEDNMTHMVTHMPDQYRIVEALIQNYNW
FFTEDGNGDPVTASRNDSAVESQPVPNIDHLLTNIGRTATSQGEVSDSPTSDSAKSKGSW
GSGKDRELLVSSIFAVASRKRKKSKEKPQPSSSDDDLDAAFAKKEIPGQKPNHHGLPAAA
QGLNAKTPARADERKENGRPAEVTPKAKREHRNSSFLKDKTPPSPNVSVHQTQARCSLSD
PLSHLDENTSDLGTMSSGASAPKSRPKNVGPAAGPGASAGAEVSSITSDYSTTSSITFLT
GAESSALSPELQGGEEADDERSELISEGRPMETDSESDFPVFAPGGGSGQSTPRPDPSLD
RTRPPEGGATPEPEARRLFPTHRMIECDTLSRRGSLRQQTDSESSAEGAAGSTERGGGKA
ESSTRLSRVLEVMKKGRSTSSLSSSSRSESERCEPAWHLKITERLKLRLRSSADDMFTQR
NRAPEARGKKKNIRRRHTMAGQRDFAELAVINDWREQRRAWDQTAELSALDRLKPRCSSQ
DFSIRDWITRERCPRPRCQDEVAPRAVAEDVHPEAGDVAPDRPSPSASPGAAGEHVNGGG
LQGKHRAALGADAHPHKLSGAQVVRSRFYQYL
Download sequence
Identical sequences G3NP08
ENSGACP00000007072 ENSGACP00000007072 69293.ENSGACP00000007072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]