SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007086 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007086
Domain Number 1 Region: 4-173
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-40
Family Phosphotyrosine-binding domain (PTB) 0.000000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007086   Gene: ENSGACG00000005363   Transcript: ENSGACT00000007104
Sequence length 666
Comment pep:known_by_projection group:BROADS1:groupXV:1596272:1609737:-1 gene:ENSGACG00000005363 transcript:ENSGACT00000007104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLRQSFRRKKDVYVPESSRPHQWQTDEEAVRSGKCSFGVKYLGHVEVEESRGMHICED
AVKRLKTERKFFKGFFAKISGVGQAGVGHLMWAPQDGLRVVDDKTKDLILDQTIEKVSFC
APDRNFERAFSYICRDGTTRRWICHCFMAVKDSGERLSHAVGCAFAACLERKQKREKECG
VTATFDANRTTFTREGSFRVTTATEAAEREEVMRQLQDAKKAETDVKVTGNSATGVTNPS
VHPAGGSPSPSSSPPPSMASLGPQVIPRRHAPAEALARQGSFRGFPVLSQTTSPFKRQMS
LRMNELPSTMQRKSDFPMKNTVAEVEGESDSISSLCTQITSAFSGPPDPFSSAPMPKPAS
SPQSPVAPVNGASPAFSAAAAANPPVLPPALPARDTNPWTKTPAGVPPSAQPVPTGSNWS
SPTPVIVVPPASSPSMSSHRRTPSEADRWLEEVTKSVRGPPANPIMAAAPLPAHFAAPVV
MPVVPVVSLTPPPFMSPLPSAVPMLPPRQPAFHAQAPVSYPMANGLPFPQPSVPVVGITP
SQMVANVFGSATQPPPPFPVPASVTPQHDPKAVCHVSPFIKPPPSIAAAPAPFQPSNGSA
TFNGGDNWAARSQLAPSSPFTQPPPEPPQDAFEAQWVAEGRSRQRTTPSPTNPFSTELHK
TFEIQL
Download sequence
Identical sequences G3NP22
ENSGACP00000007086 ENSGACP00000007086 69293.ENSGACP00000007086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]